KEGG   Serratia sp. AS12: SerAS12_4576Help
Entry
SerAS12_4576      CDS       T01502                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K10109  maltose/maltodextrin transport system permease protein
Organism
srs  Serratia sp. AS12
Pathway
srs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:srs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SerAS12_4576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srs02000]
    SerAS12_4576
Transporters [BR:srs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    SerAS12_4576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MalF_P2 BPD_transp_1 DUF4534 TM_PBP2_N DUF3339
Motif
Other DBs
NCBI-ProteinID: AEF52621
Position
4942259..4943836
Genome map
AA seq 525 aa AA seqDB search
MQLAHAGSPARKKSKWWQSDVLKWLVIGLFSLVTCYLIVLMYAQGEYLFAILTLILTSAG
LYVFANRRAYAWRYVYPGIAGMGLFVLFPLICTIAIAFTNYSSTNQLTFERAQSVLMQRQ
FQTGKTFTFGLYPAENQQWRLQLTHPDSGQQLISGPFSFDANAPQTLKLTEENAEPAGER
ATLRVITQNRQALSQLVAQLPEGGELRMSSLRQFSGTSPLYLLDKDSKVLTDQQTHIQYR
PNPDIGFYQALTADGNWAKETLSPGYTVTIGWKNFLRVLQDEGIKKPFVSIFIWTIVFSV
MTVILTVAVGMVLACVVQWEALKGKAVYRVMLILPYAVPSFISILIFKGLFNQSFGEINM
MLSHLFGIKPAWFSDPITAKSMILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAT
PMQNFFRITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDMIGTTTPAGYTDLLVS
YTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKASKMNFD
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagctcacgccgggtcgcctgcgcgcaagaagtcgaagtggtggcagagtgac
gtactgaaatggctggtgatcggcctgttcagtctggttacctgctacctgattgtgttg
atgtatgcacagggtgaatacctgtttgccattctcacgttgatcctcaccagcgccggg
ctttacgtctttgccaaccgccgcgcttacgcctggcgttacgtctatccgggcatcgcc
ggcatggggctgtttgtcctgtttccgctgatttgcaccatcgccatcgcctttaccaac
tacagcagcaccaaccagctcacctttgagcgcgcccagtcggtgctgatgcaacgtcag
ttccagaccggcaagacctttaccttcggcctgtatccggcggaaaaccaacaatggcgc
ctccagttaacccaccccgacagtggccaacaactgatttccgggccgttcagctttgac
gccaacgcgccgcaaacgctgaaactgacggaggaaaacgccgaaccggcaggagaacgc
gccacgttgcgggtgattactcagaaccgccaggcactgagccaactggtagcgcagtta
ccggaaggcggcgagctgcgcatgagctcactgcgccagttttccggcacctctccgctg
tatctgctggataaagacagcaaggtgttgaccgaccaacagacccatattcaataccgg
ccgaacccggacattggtttctatcaggcgctgactgccgacggcaactgggccaaagaa
acccttagcccaggatataccgtcaccatcggctggaaaaacttcctgcgcgttttgcag
gatgaaggcatcaaaaaacccttcgtgtcgatctttatctggaccatcgtgttctcggtg
atgaccgtgatcctcaccgtggccgtgggcatggtactggcctgcgtggtgcagtgggaa
gcgctgaaaggcaaagcggtataccgcgtcatgctgatactgccctacgcggtaccgtcg
tttatttcgattctgattttcaaggggttgtttaaccaaagcttcggtgaaatcaacatg
atgctcagccacctgttcggcatcaagccggcctggttcagcgatcccattaccgccaaa
agcatgattctgatcgtcaacacctggctgggttatccgtacatgatgatcctgtgcatg
gggctgttgaaagcgatccccgacgatctgtacgaagcctcggcaatggacggcgccacc
ccgatgcagaactttttccgcatcactctcccgctgttgatcaagccgctgacgccgctg
atgattgccagtttcgcctttaactttaacaacttcgtcttgattcagctgttgaccaac
ggcgggccggacatgatcggcaccaccacgccggccggttataccgacctgctggtcagc
tacacctaccgcatcgcctttgaaggcggcggcgggcaagacttcggtctggcggccgcg
attgccacgctgatcttcctgctggtaggcgccctggcgatcctgaatctgaaagccagc
aagatgaacttcgactag

DBGET integrated database retrieval system