KEGG   Serratia sp. AS12: SerAS12_4862Help
Entry
SerAS12_4862      CDS       T01502                                 

Definition
(GenBank) Monosaccharide-transporting ATPase
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
srs  Serratia sp. AS12
Pathway
srs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:srs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SerAS12_4862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srs02000]
    SerAS12_4862
Enzymes [BR:srs01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     SerAS12_4862
Transporters [BR:srs02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    SerAS12_4862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 RsgA_GTPase AAA_23 AAA_30 ABC_ATPase MMR_HSR1 AAA_15 TsaE DUF2813 AAA_16 Ploopntkinase3 IstB_IS21 FeoB_N DUF815 AAA_27 FUR
Motif
Other DBs
NCBI-ProteinID: AEF52906
Position
complement(5255057..5256571)
Genome map
AA seq 504 aa AA seqDB search
MAASQTTLLAIKGLSVEFPGVKALEEVDFTLQRGEIMALLGENGAGKSTLIKALTGVYQR
SAGEILLEGKAIAPQSTAQAQELGIGTVYQEVNLLANISVAANLFIGREPTRFGLVDQKT
MLRRAQQLLQGYGLQLDASQPLGNYSIAIQQIVAIARAVDLSAKVLILDEPTASLDAKEV
TMLLDILSQLRSQGIGMIFVTHFLDQVYRISDRITVLRNGRLVGTKPADDLPRLELVQMM
LGHAFDESLLKRGEHVPTDASPLVEFNGYGRRGMVEPFDLRIRPGEIVGLAGLLGSGRTE
TAQLIFGIKSHDSGSAKVEGRAVNIRTPRKAANLGFGYCPEDRKTDGIIGAATVRENIIL
ALQAQRGWLKPLSLREQTRIAESFIQLLGIRTPGPEQQIQYLSGGNQQKVLLSRWLATKP
RFLILDEPTRGIDVGAHAEIIRLIERLCDEGLALLVISSELEELAGYVDRIVVLRDRKHI
TQLEHTAITVPAIMQAIAVQQGAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatctcagaccacgttattggcgattaagggactatccgtcgagtttcctggc
gtaaaggcgctggaagaggttgatttcacgctgcagcgcggagagatcatggcgttgttg
ggtgaaaacggcgcggggaaatccacgctaatcaaagcgctgaccggggtttatcagcgt
tccgccggtgaaatcctgctggagggcaaagccattgcgccgcaaagcaccgcgcaagcg
caggagttggggattggtacggtttatcaggaagttaacctgctggcgaatatctcggtg
gccgccaatttgtttatcggccgcgaacctacccgtttcggcctggtcgatcaaaaaacc
atgctgcggcgggcccagcaacttttgcagggctatgggttgcagctggatgccagccag
ccattgggcaattattcgattgcgatccagcagattgtcgccatcgcccgggcggtcgat
ctttcagccaaagtcctgatcctggatgaacccactgcgagcctggatgctaaagaagtc
accatgctgctggatattctcagtcagctgcgttcgcaggggataggcatgatctttgtc
actcatttcctcgatcaggtttaccgtatcagcgatcgcattaccgtgctgcgcaacggt
aggttggtgggtaccaagcctgccgacgacttgccacggctggagctggtccagatgatg
ctcggtcacgcctttgacgagtcgttgctcaagcggggcgagcatgtaccgacggatgcg
tctccgctggtcgaatttaacggctacgggcgtcgtggcatggttgaacccttcgatctg
agaataaggccgggtgagattgtcggattggcaggcctgctcggttcggggcgaaccgaa
acggcccaactgatatttggcatcaaatcgcatgatagcggcagtgcgaaagtggagggt
cgcgcggtgaatattcgcacaccgcgcaaagctgccaatctcggcttcggttattgcccg
gaggatcgtaaaaccgacggaattatcggtgctgcgacggtgcgagaaaatatcattctg
gctctgcaggctcagcgcggctggttaaagccgctctcgctacgagagcaaacccgcatt
gccgagagttttatccaattattaggtatccgcacgccgggcccggagcaacagatccaa
tacctgtccggagggaatcagcagaaggtgctgctgtcacgttggttggcaaccaaaccc
cgttttctgatcctggatgaaccgacgcgcgggattgacgttggtgcgcatgcagaaatt
atcaggctgatcgaaaggttgtgtgatgaaggattagcgctgctggtgatctcttctgag
ttggaggaactggcgggatatgtcgatcgcatcgtggtattgcgcgacaggaaacacatt
acacagcttgagcatacggctattacggtacctgcgattatgcaggctattgctgtgcaa
cagggggcaggatga

DBGET integrated database retrieval system