KEGG   Segniliparus rotundus: Srot_0704Help
Entry
Srot_0704         CDS       T01238                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
srt  Segniliparus rotundus
Pathway
srt00780  Biotin metabolism
srt01100  Metabolic pathways
Module
srt_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:srt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Srot_0704
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srt01007]
    Srot_0704
Enzymes [BR:srt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Srot_0704
Amino acid related enzymes [BR:srt01007]
 Aminotransferase (transaminase)
  Class II
   Srot_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Aminotran_3 Cys_Met_Meta_PP PALP SHMT Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADG97186
UniProt: D6ZDC2
Position
693218..694369
Genome map
AA seq 383 aa AA seqDB search
MPEIARTSFQDWLEGAARRREQLGLRRIMTPKRVCASLLDFASNDYLGLSQDPRVLEGAA
MALKEHGAGSTASRLVAGTTELHESFERQLAAFFGTEAALVFSSGYLANLAAVSALGGSD
AVIVSDAGVHASLIDAGRLSRSRVVVTPSGSVESVRDALAARAEPRALVVVDSVSSVDGS
LAPLVELHKLCQEFGAVLIADEAHALGVVGPGGRGHAYAQGVAGQPDVVLTATLSKALGG
QGGAVLASGAVREHLLNSARSFIFDTALAPPCVGAAAAALGVLTAEPALPAMVLERAQEL
AERLGLAERAQSSVLSTVLGDPNVAVAVAAACREEGVLVGCFRPPSVPEGTSRIRFAVKA
THSSADVCRAVSVFSESRRACLS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaattgcgcgcacctcgttccaagactggctcgaaggggcagcccgccgccgt
gagcagttgggactgcgccgcatcatgacccccaaacgggtgtgcgcgagtctcctcgat
ttcgcgtccaacgattatcttggcctctcccaagacccgcgtgtgctcgaaggcgcggcg
atggcgctcaaagagcacggcgcggggtcgaccgcttctcgcctggtcgctgggaccaca
gagctgcacgagtcgtttgagcggcagctcgcggcatttttcgggacggaggcggcgctt
gtgttctccagcggatatctcgcgaaccttgccgcagtctccgcgctgggcggcagtgac
gcggtcattgtttcggacgcgggcgtgcatgcttctctgatcgacgcgggcaggctttcg
cgctcccgtgtcgtggtcactccctcaggctcggtcgagtcggtgcgcgacgcgctcgcc
gcccgtgccgagcctcgcgccttggtggtcgtggactccgtgtccagcgtcgacgggagt
cttgcgccgctcgtcgagttgcacaaactatgccaggagttcggcgcggtgctgatcgcg
gacgaggcgcacgcgctcggggtggtcggcccaggaggacgtgggcacgcctacgcgcag
ggcgtcgcggggcagccggacgtggtgctcaccgcaactctgtcgaaggcgctgggcggc
caaggcggcgctgtcctcgcgagcggcgcggttcgggagcatttgctcaacagcgcgcgc
agttttattttcgacaccgccctggctccgccgtgcgtcggcgctgctgctgccgcgctc
ggcgttctgaccgccgaacccgcgctgcccgcaatggtgctcgagcgcgctcaggagctc
gccgaacgcctcggccttgccgagcgtgcgcagtcgagcgtcctctcgactgtcctcggc
gatccgaacgtcgctgtcgccgtcgcggcggcctgccgggaagagggcgtgctcgtcggg
tgcttccgtccgccctcggtgccggaaggcacgagccgaatccgtttcgcggtcaaagcg
acgcatagttcggcggacgtctgccgtgccgtttcggtgttctcggaatcgaggcgcgcg
tgcctgtcgtag

DBGET integrated database retrieval system