KEGG   Segniliparus rotundus: Srot_1864Help
Entry
Srot_1864         CDS       T01238                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
srt  Segniliparus rotundus
Pathway
srt00020  Citrate cycle (TCA cycle)
srt00620  Pyruvate metabolism
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
srt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Srot_1864
   00620 Pyruvate metabolism
    Srot_1864
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Srot_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADG98324
UniProt: D6Z8P4
Position
complement(1877062..1878579)
Genome map
AA seq 505 aa AA seqDB search
MPEHTAPALSTKKTGSAILETDVALIGAGIVSATLGSLLRQVQPDWSIAVFERLPGAAQE
SSSPWNNAGTGHSALCELNYTPLQPDGSVDITKAVAINEQFQVSRQFWSSLVQAGHLSEP
KQFINPISHMSWVTGQEDADYLKARHEALVRHPLFSNMGFSTDPGEFAKRLPLMARGRDF
SEPFAITWEDDGTDVNFGELTRQLLAHVAGAGPLLFEHEVTSLKRDGERWKLSVKNLRTG
EKTTARAKFVFVGAGGYALPLLQSAGVPSVKGMGGFPISGAFLRCTNPDIVAQHQAKVYA
KAKGSAPPMSVPHLDTRVIDGKRSILFGPYAGWSPKYLKEGRLTDLVASLRPMNILPYLS
VGLTEFGLVKYLVSQLLQSSSDRIAALQDFVPSAEASDWDLYFAGQRVQIIRGKGAKGAL
EFGTAVEATPDGTVAGLLGASPGASVCASAMLSLLERCFPKDHERWSGKLKELVPSYGTK
LSDNPQLHQRLFEESAKALELTPAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcacacagcccctgcgctatccaccaaaaagactggttccgccattctggag
acggacgtggccctgatcggggcgggaattgtgagcgcaacgctcggctccctcctgcgc
caggtgcagccggattggtccatcgcggtcttcgagcgccttccgggcgcggcgcaagag
tccagctcgccgtggaacaacgcgggcaccggccactcggcgctctgcgagctcaattac
accccgttgcaaccggacggctccgtggacatcacgaaagccgtggcgatcaatgagcaa
ttccaggtgtcgcggcagttctggtcgagcctggtccaggcggggcacctgagcgagccg
aagcagttcatcaacccgatttcgcacatgagctgggtgaccggccaggaggacgccgat
tacctcaaagcccggcacgaggcgcttgtgcggcatccgctcttctcgaacatgggcttc
tcgaccgaccccggcgaattcgccaagcgtctgccgctcatggcccgaggccgcgacttc
tccgaaccgttcgcgatcacatgggaggacgacggcaccgatgtgaacttcggcgagttg
acccgtcagctcctcgcgcacgtcgcgggcgcgggaccgctcctgttcgagcacgaggtg
acgagcctgaaacgcgacggcgagcgttggaagttgtcggtgaagaacctgcgcaccggg
gaaaagaccacggccagggcgaagttcgtgttcgtcggcgccggcggctacgcactgccg
ctcttgcagtccgcgggcgtgccctcggtcaagggcatgggcggattcccgatctccggg
gccttcctgcgttgcacgaacccggacatcgtcgcccagcaccaggccaaggtctacgcc
aaggccaaagggtccgccccgccgatgtccgtgccgcacttggacaccagggtgatcgac
gggaagcgcagcattctcttcggcccatacgcgggctggtccccgaagtacttgaaagaa
ggccgtctcacggacctcgtcgcttctctgcgcccgatgaacatcctgccgtacctttcg
gtgggcctcaccgaattcggcctggtgaaatacctcgtcagccagctgctgcaatcgtcg
tcggaccggatcgcggcgttgcaggacttcgtcccctccgccgaggcctccgattgggac
ctgtatttcgcggggcagcgggtgcagatcatccgcggcaagggcgcgaagggcgcgttg
gagttcggcaccgccgtggaggccacgccggacggaacggtggccgggttgctcggggcc
tcgcccggagcgtccgtgtgcgcgtccgcgatgctctccctcctggagcgctgcttcccg
aaggaccatgagcgctggagcgggaagctcaaagagctcgtgccgtcgtatgggacgaag
ctttcggacaatccgcagctccaccagcgcctgttcgaagaatctgcgaaagcgctcgag
ctgaccccggcctcttga

DBGET integrated database retrieval system