KEGG   Segniliparus rotundus: Srot_2248Help
Entry
Srot_2248         CDS       T01238                                 

Definition
(GenBank) putative magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
srt  Segniliparus rotundus
Pathway
srt00860  Porphyrin and chlorophyll metabolism
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Srot_2248
Enzymes [BR:srt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Srot_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3 MCM AAA_PrkA NACHT AAA_16 DUF2939 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ADG98698
UniProt: D6ZA28
Position
2276589..2277992
Genome map
AA seq 467 aa AA seqDB search
MAKLVKVTFEEHAKPTTLGELRASGHRERSVKQEIAENLLAALKEGRNPWPGLFGLENTV
LPQLERALIAHHDFVLLGERGQGKTRLLRSLAGLLDEWTPVIQGSELGEHPYRPITPASI
RRAAELGDGLPVAWKHRSERYTEKLATPDTSVGDLIGDIDPVKVAEGRSLGDPDTIAYGL
VPRAHRGIVAINELPDLAERIQVAMLNVMEERDIQVRGHTLRLPLDVLMTASANPEDYTN
RGRIITPLKDRFGAEIRTHYPADLDAEVEVIEQEASLSANVPRYLAEIVARCTQLLRESS
SVDQRSGVSARFSIAAAETVAAAALRRAALTGETEAVARIVDLGSVVDVLRGKIEFESGE
EGREQEILSHLVRRATADVARRHLAGVDVGPLLAAVENGQSVTTGEVVPAKDVLASVENL
AVVDVVARQLGAASTGERAGAVELALEALYLARRLDKVSDSKTSVYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtggctaagctggtcaaggtgacgtttgaggagcacgcgaaaccgacgaccctgggagag
ctccgagcctcggggcacagagagcgatcggtgaagcaagagatcgcggagaacctcttg
gcggcgctgaaggaagggcgaaacccttggccagggctgttcggactcgagaacacggtc
ctcccccagctcgaacgcgcgctcatcgcgcaccacgactttgtgctcctcggcgagcgc
ggccaaggcaagacccgcttgctccgctccctggcagggctcctggacgagtggaccccg
gtgatccaaggttccgagctcggcgagcacccctaccggccgatcacccccgcgtcgatc
cggcgcgccgccgaactcggcgacggcctgccggtggcctggaagcaccgcagcgagcgg
tacaccgaaaaactcgcgaccccggacacttcggtgggcgacctgatcggcgacatcgac
ccggtgaaagtcgccgagggccgcagcctcggcgatcctgacaccatcgcctacggcctg
gtccccagggcgcaccgagggatcgtcgcgatcaacgagctgcccgacctcgccgaacgc
atccaggtcgccatgctcaacgtcatggaggagcgcgacatccaggtccggggccacacg
ctgcgcctgcccttggacgtgctcatgacagcctcggcgaacccggaggactacacgaac
cgcggccggatcatcacgccgctcaaggaccgcttcggggcagagatccgcacccactac
cctgccgatctggacgcggaagtcgaagtgatcgagcaggaggcgagcctgtccgcgaac
gtgccccgctacctcgccgaaatcgtcgcgcgctgcacgcagctcctgcgcgagtccagc
tctgtcgaccaacgctccggggtctccgcccggttctcgatcgccgccgcggagacggtg
gcggccgccgcgctgcgccgcgccgccctgaccggcgagacggaggccgtggcccgcatc
gtggacctcggctcggtcgtcgacgtgctgcgggggaaaatcgaattcgaatccggcgaa
gagggccgcgagcaggaaatcctcagccaccttgtgcgccgggcgaccgccgacgtcgcg
cgtcggcatctcgcaggcgtcgacgtcgggccgctcctggccgcggtggagaacgggcag
agcgtgaccaccggcgaggtggtcccggcgaaagacgtgctcgcctcggtggaaaatctc
gccgttgtggacgtcgtcgcccgccagctcggcgcggcgagcaccggcgagcgggcgggc
gcggtggaactggctctggaagcgctctacctcgcgcgcaggctcgacaaagtctccgac
tcgaagacctcggtgtatggctga

DBGET integrated database retrieval system