KEGG   Segniliparus rotundus: Srot_2942Help
Entry
Srot_2942         CDS       T01238                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
srt  Segniliparus rotundus
Pathway
srt00984  Steroid degradation
srt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Srot_2942
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Srot_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO GMC_oxred_C GMC_oxred_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 GIDA HI0933_like Fer4_9 FAD_oxidored Pyr_redox Fer4_8 3HCDH_N Fer4
Motif
Other DBs
NCBI-ProteinID: ADG99371
UniProt: D6ZDW4
Position
3036742..3038445
Genome map
AA seq 567 aa AA seqDB search
MPENRDFDVLVIGSGFGGSVTALRLAEKGYSVAVLEAGRRFADNELPKTNWNVRKFLWAP
KLGAFGVQRIHFLPDCTVLAGAGVGGGSLNYANTLYVPKDAFFNDPQWAHITDWKSELAP
HYEQAKKMLGVTRNPKPTNSDRHMRAVAEDMGVGDTFVPTPVGVFFDKPGVRVPDPFFGG
AGPERTGCTECGSCMTGCRVGAKNTLVKNYLALAEQAGAKVFPLTEVREVRQRQDGTWEA
RARHPSAWFGTATSVFTARNVVVAAGTWGTQQLLHRMKAEGVLPKLSDRLGELTRSNSES
ILGAARRAVAEDDNLSQGVAITSSFHPEENTHIEPVRYGKGANAMFALGTLLTHGDGPGP
RWLTFLRQAARSPGALLRTLNLRRMSERTIVVLVMQTLDNSLTTFVKKGLFGTRLSSKQG
HGLPNPTWIPVGNETARRVADKIGGDAFGCWPDVFNLTMTAHFIGGAAISDTPQQGVIDP
YHRVWGYPTLFVTDGAAVSANLGVNPSLSITAQAERAASLWPNKGEEDPRPAQGQLYRRV
EPVAPKNPQVPAWAPAALGWPTVRQEA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaaccgtgatttcgacgtgctcgtcatcggttctggattcggaggcagcgtc
accgcgctgcggctcgcggagaagggctacagcgtggccgttctcgaagcgggcagacgg
ttcgccgacaatgagctgccgaagacgaactggaacgtccgcaagttcctctgggccccc
aaactcggcgcgttcggcgtgcaacgcatccacttcctgcccgactgcacggtgctcgcc
ggggccggggtgggcggcggctcgttgaactacgccaacacgctgtacgtcccgaaggac
gcgttcttcaacgacccgcagtgggcgcacatcaccgactggaagtccgagctggccccg
cattacgagcaggcgaagaagatgctcggcgtgacgcgcaacccaaagccgacgaactcg
gaccgccacatgcgggccgtggccgaggacatgggggtcggcgacaccttcgtccccacc
ccggtgggggtcttcttcgacaagccgggcgtccgcgtgcccgatcccttcttcggcggc
gcgggaccggagcgcaccggctgcaccgagtgcggctcgtgcatgaccggctgccgtgtc
ggcgcgaagaacaccctggtgaaaaactacctcgccctcgccgagcaggccggcgcgaaa
gtcttcccgctcaccgaggtccgcgaagtgcgccaaagacaggacgggacgtgggaggcg
cgcgcccggcatcctagcgcgtggttcggcacagccacgagtgtgttcaccgcgcgcaac
gtcgtggtcgcggctggcacctggggcacccagcagctcctgcaccggatgaaggccgag
ggcgtgctgccgaagctgtcggaccgtctcggcgagctcacccgcagcaactcggagtcc
atcctgggcgcggcgcggcgcgcggtggccgaggacgacaacctcagccagggcgtggcg
atcacatcctccttccacccggaggagaacacgcacatcgaaccggtccgctacgggaag
ggcgcgaacgccatgttcgcgctcggcaccctgctcacccacggcgacgggcccggcccg
cgctggctgacgttcctgcggcaagcggcccgcagccccggcgcgctgctgcgcacgctg
aacctgcgccggatgagcgaacggacgattgtcgtgctcgtcatgcagaccctcgacaac
tcgctcacgacgttcgtcaaaaagggcctcttcggcacgcggctgtcctccaagcaaggc
cacggcctgcccaacccgacctggattcccgtcggcaacgagaccgcgcggcgggtcgcg
gacaagatcggcggcgacgcgttcgggtgctggccggacgtcttcaacctgaccatgacg
gcgcacttcatcggcggggccgcgatctcggacaccccgcagcagggcgtgatcgacccc
tatcaccgcgtctggggctatccgacgctgttcgtgacggacggagccgccgtctcggcg
aacctcggcgtgaacccgtccttgtcgatcaccgcccaagccgagcgcgcggcctcgctg
tggccgaacaaaggcgaagaagacccccgccccgcccagggccagctctaccggcgcgtc
gagccggtggccccgaagaacccgcaagtgcccgcctgggccccggcggcgttgggatgg
ccgaccgtgcgccaggaggcgtaa

DBGET integrated database retrieval system