KEGG   Salinibacter ruber DSM 13855: SRU_0030Help
Entry
SRU_0030          CDS       T00312                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00230  Purine metabolism
sru01100  Metabolic pathways
Module
sru_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SRU_0030
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SRU_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_16 AAA_18 NTPase_1 AAA_33 AAA_25 AAA_17 AAA_30 Mg_chelatase AAA AAA_24 AAA_23 APS_kinase cobW PRK AAA_19 MobB
Motif
Other DBs
NCBI-GeneID: 3852697
NCBI-ProteinID: YP_444186
UniProt: Q2S6J5
Position
complement(28890..29456)
Genome map
AA seq 188 aa AA seqDB search
MPDRNIVVLTAPSGAGKTTIAHRVLEAMPDMQFSVSATTRAARPDETDGVDYHFLSPEEF
RARIDAGDLLEYEEVYPDQFYGTLRSEVEDRAEDGPVLLDIDVKGALNVKRIFGDDALIL
FVAPPSLDELQRRLEGRGTEDRESLQDRLDRVEQEMDRADDCDAVVVNDDLDPAVEETLT
RIRQFLSS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccgcaacatcgtcgtactgacggccccgagcggcgccggcaagaccaccatt
gcccatcgggtactggaggcgatgccggacatgcagttttccgtatcggccacgacgcgt
gccgcccgccccgacgagacggacggggtggactaccactttctctcccccgaggaattt
cgcgcccggatcgatgccggtgacctgctcgagtacgaagaggtgtaccccgatcagttt
tacgggacgctccgctcggaggtcgaagatcgggccgaggacggccccgtgctgctcgat
attgacgtgaaaggggcgctcaacgtcaagcgcattttcggggacgacgccctcatactg
ttcgtggcccctccgtccctcgacgagttgcagcgccggctcgaaggacgtggcaccgag
gaccgtgagtcgcttcaggaccgcctcgaccgggtcgagcaggaaatggatcgggccgac
gactgcgatgcggtggtcgtgaatgatgacctggaccctgcggtcgaggaaaccctcacc
cgaattcgtcagtttctgagttcgtga

DBGET integrated database retrieval system