KEGG   Salinibacter ruber DSM 13855: SRU_0033Help
Entry
SRU_0033          CDS       T00312                                 

Gene name
frr
Definition
(RefSeq) ribosome recycling factor
  KO
K02838  ribosome recycling factor
Organism
sru  Salinibacter ruber DSM 13855
Brite
KEGG Orthology (KO) [BR:sru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sru03012]
    SRU_0033 (frr)
Translation factors [BR:sru03012]
 Eukaryotic type
  Release factors
   SRU_0033 (frr)
 Prokaryotic type
   SRU_0033 (frr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRF Nop16
Motif
Other DBs
NCBI-GeneID: 3850587
NCBI-ProteinID: YP_444188
UniProt: Q2S6J3
Position
complement(30705..31274)
Genome map
AA seq 189 aa AA seqDB search
MPDDPIQDILDEADEEMEESVSYMRSELRTIRAGRASPAMLENVTVEYYGSQTPLEQVAS
VSAPQPDLIVVQPFDRNAIENIERGIMKADLGLNPNNDGEKIRIPIPPLSEERRKELVET
SRERAEETKISIRNIRRDAKNEIQNVVEAENFSEDVLYGAEEDLQDITDAHTETVEGLLE
QKTEQIMDV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgaccccattcaggacattctggacgaggccgacgaggagatggaggagtcg
gtatcgtacatgcgttcggagctgcgcacgattcgcgccggacgggcctccccggccatg
ctcgaaaacgtgacggtcgaatactacggctcccagacccccctggagcaggtcgccagc
gtgagcgcgccgcagcccgacctcatcgtcgtgcagccgttcgaccgcaacgccatcgaa
aacatcgaacggggcatcatgaaggccgacctcggcctaaacccgaacaacgacggcgag
aagatccgcattccgatcccgcccctctccgaagagcggcgcaaggagctcgtggagacc
agtcgcgagcgggccgaagaaacgaagatttcgatccgcaacatccggcgcgacgccaag
aacgagatccagaacgttgttgaggcggaaaacttctccgaggacgtgctctacggcgcc
gaggaagaccttcaggacatcaccgacgcccacaccgaaacggtggaggggcttctggag
cagaaaaccgaacagattatggacgtttaa

DBGET integrated database retrieval system