KEGG   Salinibacter ruber DSM 13855: SRU_1669Help
Entry
SRU_1669          CDS       T00312                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00260  Glycine, serine and threonine metabolism
sru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01130  Biosynthesis of antibiotics
sru01230  Biosynthesis of amino acids
Module
sru_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRU_1669 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRU_1669 (trpB)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SRU_1669 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3850444
NCBI-ProteinID: YP_445788
UniProt: Q2S1Z3
Position
2071644..2072864
Genome map
AA seq 406 aa AA seqDB search
MSSPATTSRADTLPDTDGHFGSYGGAFVPETLTPVLEELKAAYDTYKDDPDFQADLRALL
REYAGRPTPLSYCDRLTERIGGARIYAKREDLCHTGAHKINNTLGQILLATRMGKERIIA
ETGAGQHGVATATVCAKFGVDCVIYMGAEDMERQRLNVERMELLGAEVRAATSGSQTLKE
ATNEAIRDWVSNPDDTFYIIGSVVGPHPYPMMVRNFHRVIGTETRRQLREETGRETPDAI
AACVGGGSNAIGIFHPFLDDPEVQLHGTEAAGGGLDGDHAATLAEGSPGVLHGAMSYLLQ
DDAGQVSLAHSLSAGLDYPGVGPEHAHLRDEGRVSYHPVTDDEALDGVELLSQTEGIIPA
LETAHAVALLPELARTLAEERGDDAVLVFNCSGRGDKDMQTIAAHR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcccgctaccacgtctcgtgcggacaccctccccgataccgatggccacttc
ggctcgtacgggggagcgttcgtgccggagacccttacccctgtactggaggagttgaag
gccgcctacgacacgtataaggacgacccggacttccaggccgacctccgcgccctcctc
cgtgaatacgccgggcggcccacccccctctcctactgcgaccgcctgaccgaacggatc
ggcggggcccgcatctacgcgaagcgggaagacctttgccacaccggggcccacaaaatt
aacaacacgctcggccagatcctgctggcgacgcgcatgggcaaggagcgcatcattgcc
gaaaccggggccgggcagcacggggtggccaccgccacggtctgcgccaagttcggcgtc
gactgcgtgatttacatgggggcggaggacatggaacgccagcgcctcaacgtggagcgc
atggagctgctgggcgcggaggttcgggcggcgacctcgggcagccaaaccctgaaggag
gccaccaacgaggccattcgggactgggtgtccaacccggacgacacgttctacatcatc
ggctccgtcgtgggcccgcacccctatcccatgatggtgcgcaactttcaccgggtgatc
ggcaccgagacgcgtcgccagctccgtgaggagaccggccgggagacgccggacgccatc
gcggcctgcgtggggggcggctccaacgccatcggcatcttccatccgttcctcgacgac
cccgaggtgcaactgcacgggacggaggcggcgggcggcggcctcgacggcgaccacgcg
gccacccttgccgaggggtcgccgggcgtcctgcacggggcgatgagctacctcctgcag
gacgacgccggtcaggtgagcctcgcccactcgctctccgccggcctcgactaccccggc
gtggggcccgagcacgcccacctgcgcgacgagggacgcgtctcgtaccacccggtgacc
gacgacgaggccctggacggggtggagcttctctcccaaacggaaggcatcatcccggcg
ctcgaaacggcgcacgccgtcgccctcctgcccgagctggcgcgcaccctggccgaggag
cgcggggacgacgccgtcctcgtctttaactgctccggccggggcgacaaggacatgcag
accatcgccgcacaccggtaa

DBGET integrated database retrieval system