KEGG   Salinibacter ruber DSM 13855: SRU_1684Help
Entry
SRU_1684          CDS       T00312                                 

Gene name
acs
Definition
(RefSeq) acetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00010  Glycolysis / Gluconeogenesis
sru00620  Pyruvate metabolism
sru00640  Propanoate metabolism
sru00680  Methane metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_1684 (acs)
   00620 Pyruvate metabolism
    SRU_1684 (acs)
   00640 Propanoate metabolism
    SRU_1684 (acs)
  Energy metabolism
   00680 Methane metabolism
    SRU_1684 (acs)
Enzymes [BR:sru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SRU_1684 (acs)
Lipid biosynthesis proteins [BR:sru01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SRU_1684 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 3851639
NCBI-ProteinID: YP_445803
UniProt: Q2S1X8
Position
complement(2087745..2089736)
Genome map
AA seq 663 aa AA seqDB search
MADADAALEARLSDQEYLRPPSAFVGQANVSDPAIYDRFDDFPEGFEEYADLLDWDTRWD
EVFDGSDPPFFEWFTGGELNACYNCVDRHLHERPNQAAFIWEGEDGTRRTLTYRDLYREV
NKMAASLRDVGVQEDDVVTLHLPMVPALPITMLACARIGAPHSVVFGGFSASALAQRATD
ADSDVIVTIDGYYRRGEFLHHKEKADTAVEEADTDIDTVLVWERHEGTLHPEADLEEGRD
ILVSELLANNERARVEPVSRDAEDTLFLMYTSGTTGKPKGAQHRTGGYLSYVAGTSKYVL
DIKPNDTYWCAADIGWITGHSYIVYGPLALGTTSVMREGAPDHPHKGVTWEIAERHDVDI
FHTSPTAVRMYMKWGKEHPASYDFNFRHMTTVGEPIQPEAWLWYYTHIGNEDAVIVDTWW
QTETGGHLITNLPALQDMKPGSAGRPCPGIQPAIYDNNGTPVEAASGQAGNLVIERPWPG
MLQTVYGDDQRFINEYWRRFSDVDSDDWRDWVYEAGDGAVHAQDGYFRVLGRLDDVMNVA
GHRLGTMELESAVAQVSEVAEAAVAARQDDQKGNVPDVYVTPRDGVAASDELRQDIVAAV
EKEIGAFARPGNVIFVGDLPKTRSGKIMRRLLENISNGKDLGDTTTLRDPSVPEEIRRQV
QEA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccgacgctgccctcgaagcccgactgtccgaccaggagtatctccgccct
ccctccgcattcgtggggcaggccaacgtgtcggacccggcgatctacgatcggttcgac
gactttccggaaggatttgaggagtacgccgaccttctggactgggacacccgctgggac
gaggtcttcgacgggtccgacccgcccttcttcgagtggtttacgggcggggagctcaac
gcctgctacaactgcgtggaccgtcacctccacgagcggcccaaccaggcggccttcatc
tgggagggcgaggacggcacccggcgcacgctgacgtaccgggatctctaccgggaagtc
aacaagatggcggcctcgctccgcgacgtgggggtccaggaggacgacgtggttacgctc
caccttccgatggtgcccgcgctgcccatcaccatgctcgcctgtgcccgcatcggcgcg
ccgcactcggtcgtctttggcggcttctcggccagcgccctcgcccagcgcgccaccgat
gccgactccgacgtcatcgtcacgatcgacggctactaccggcggggcgagttcttgcac
cacaaggagaaggccgacaccgccgtggaggaggcggacaccgacatcgacacggtgctg
gtgtgggagcgccacgagggaacccttcaccccgaggccgacctggaggagggacgcgac
atcctcgtgtccgagctcctcgccaacaacgaacgggcgcgagtcgagccggtgtcgcgc
gacgccgaagacactctcttcctgatgtacacgtccggcaccaccggcaagccgaagggg
gcccagcaccggaccggcggctacctcagctacgtggcgggcacgtcgaagtacgtcctc
gacatcaagcccaatgacacctactggtgtgccgccgacatcggatggattaccggccac
tcctacatcgtctacggcccgctcgccctaggcacgacgagcgtgatgcgggagggcgcg
cccgaccatccgcacaagggcgtcacctgggaaattgccgagcggcacgacgtcgacatc
ttccacacctcccccacggcggtgcggatgtacatgaagtgggggaaggagcacccggcg
tcgtacgacttcaacttccgccacatgacgacggtcggggagcccattcagccggaggcg
tggctctggtactacacgcacatcggaaacgaggacgccgtcatcgtcgacacctggtgg
cagacggagacggggggccacctcatcaccaacctgccggccctacaggacatgaagccc
ggctcggccgggcgtccgtgccccggcatccagccggccatctacgacaacaacggcacg
cccgtggaggccgcgagcgggcaggccggcaacttggtgatcgagcgcccctggccgggc
atgctgcagaccgtgtacggcgacgaccagcgcttcatcaacgagtactggcgccgcttc
tcggacgtcgactccgacgactggcgcgactgggtctacgaggccggggacggggccgtg
cacgcccaggacggctacttccgcgtcctggggcgcctcgacgacgtgatgaacgtggcc
gggcaccggctcggcaccatggagctggagtcggccgtggcccaggtgtccgaggtggcc
gaggccgcagtggccgcccggcaggacgaccagaagggaaacgtgcccgacgtgtacgtc
acgccccgcgacggggtggcggcgtccgacgagctccggcaggacatcgtcgccgccgtt
gagaaagagatcggggcctttgcccgcccgggaaacgtcatcttcgtcggggatctcccc
aagacgcgctccggcaagattatgcgtcgcctcctcgaaaacatctccaacgggaaggac
ctcggcgacaccaccaccctccgcgacccgagcgtccccgaagaaatacggcggcaggtt
caggaggcgtag

DBGET integrated database retrieval system