KEGG   Salinibacter ruber DSM 13855: SRU_1827Help
Entry
SRU_1827          CDS       T00312                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00230  Purine metabolism
sru00250  Alanine, aspartate and glutamate metabolism
sru01100  Metabolic pathways
Module
sru_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sru00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SRU_1827 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SRU_1827 (purA)
Enzymes [BR:sru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SRU_1827 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 3850405
NCBI-ProteinID: YP_445940
UniProt: Q2S1J1
Position
complement(2260037..2261356)
Genome map
AA seq 439 aa AA seqDB search
MPVSIVIGSQWGDEGKGKIVDLLSPDVDIVARYQGGANAGHTIVWDEEGETEEFVLHLVP
SGIFHEGVTCVIGNGVVLDPKAILEEIEKIESLGIDVEGRLKISHNAHLIMPYHKAIEAA
QEEDRASASDDDEIGTTGRGIGPAYTDKFARTGIRVVDLLDEDVLRRKLRRSIEEKNAIL
RDVYDAEALDVDRIVEEYVEFDQKIDDYVTDTSAYLSRALDDGARVLAEGAQGSLLDVDF
GSYPYVTSSHPTAGGCCTGLGVSPTEIDRVLGIAKAYCTRVGNGPFPTELDGEVGQALRE
KGGEFGATTGRPRRCGWLDLVALRYTCMVNGFNELALTKLDILSGIDELKVCTEYRYDGK
TTRRFPSEPQNLTRVEPQYETLPGWEADISAVRHVDDLPRAAQDYLAFIENYLDVEIGLV
SNGPRRSQIITDVQPMAAA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccagtctctatcgtaattggaagccagtggggcgatgaggggaaggggaaaattgta
gacctcctgagcccggacgtcgacatcgtggcccgctaccagggcggcgccaacgccgga
cacaccattgtgtgggacgaggagggggagaccgaagagttcgttctccacctcgtgccg
agcggaatctttcacgaaggggtcacctgcgtcatcgggaacggggtggtgctggacccg
aaggccattctggaagagatcgagaagattgagtccctgggcatcgacgtggaggggcgg
ctgaagatctcccacaacgcccacctcatcatgccgtaccacaaggcgatcgaggcggca
caggaggaggatcgggcctccgcgtccgacgacgacgaaatcgggaccacgggacgcggc
atcgggcccgcgtacaccgacaagttcgcccgcaccggcatccgggtggtggacctgctc
gacgaggacgtgctgcgccggaagctccggcgctccatcgaggagaaaaacgccatcctc
cgggacgtctacgacgcggaggcgctggacgtcgaccgcatcgtggaggagtacgtcgag
ttcgatcagaaaattgacgactacgtcaccgacacctcggcgtacctctcgcgtgccctc
gacgacggggcccgcgtgctggccgagggcgcgcaggggtcgctccttgacgtcgacttt
ggcagctatccgtacgtgacctccagtcaccccacggccggcggatgctgcaccgggctc
ggcgtctcgcccaccgagatcgaccgcgtcctgggcatcgcaaaggcgtactgcacgcgt
gtcggcaacggacctttccccacggagctcgacggcgaggtcgggcaggcgctgcgggag
aagggcggtgagtttggggccacgacgggccgtccccgtcggtgcggctggcttgacctg
gtggccctgcgctacacctgcatggtgaacggcttcaacgagctggccctgaccaagctc
gacatcctctccgggatcgacgagctgaaggtgtgcacggagtaccggtacgacggcaag
acgacccggcgcttcccgagtgagccgcagaatctcacccgcgtggagccgcagtacgaa
accctgcccgggtgggaggccgacatttcggcggtccgccacgtcgacgacctgccccgg
gcggcccaagactacctcgccttcatcgagaactacctcgacgtagagatcggattggtc
tcgaacgggccgcgccgcagccagatcatcacggacgtgcagccgatggccgcggcctga

DBGET integrated database retrieval system