KEGG   Salinibacter ruber DSM 13855: SRU_2373Help
Entry
SRU_2373          CDS       T00312                                 

Gene name
pckA
Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00010  Glycolysis / Gluconeogenesis
sru00020  Citrate cycle (TCA cycle)
sru00620  Pyruvate metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
Module
sru_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_2373 (pckA)
   00020 Citrate cycle (TCA cycle)
    SRU_2373 (pckA)
   00620 Pyruvate metabolism
    SRU_2373 (pckA)
Enzymes [BR:sru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     SRU_2373 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-GeneID: 3852121
NCBI-ProteinID: YP_446473
UniProt: Q2S008
Position
2950300..2951892
Genome map
AA seq 530 aa AA seqDB search
MSDLDLSQYGITPDTTLRNADPARLYEEAIHYDPTAAIAHSGALTIRSGEKTGRSPADKR
IVRHPNSEDDIWWGPINMEIDDHTFEINKERAQDYLNTRQRIYVMDGFAGWDPAHRLKVR
IICSRPYHALFMHNMLIRPSQEELASFGEPDFVIYNAGEFPANRQTKHMSSKTSVDLSFE
NQEMVILGTEYAGEMKKGVFTVMHYLMPKKDVLSMHCSANEGDEGDVSLFFGLSGTGKTT
LSADPNRKLIGDDEHCWSDDGVFNIEGGCYAKAVGLSEEEEPEIYNAIRYGTVLENMVYD
EDTRAVDYDDTSITQNTRASYPLDYIDRAKIPGMGGHPDNIIFLTYDAFGVMPPVSKLTP
EQAMYHFISGYTAKVAGTEVGVDEPQATFSACFGAAFLVWPPDKYAEMLAEKIRAHDAEA
WLVNTGITGGPYGVGHRVPLEHTRAMIDAIHDGSLLDAPKKTEPVFGLDVPTECPNVPND
ILMPRETWDDPQAYDEKAEHLVGLFHDHFEKYEDEAAPAIAEAGPQLQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcttgacctgtctcagtacggcatcacccccgacaccacgctccgcaacgcg
gatccggcgcgcctctacgaggaggccatccactacgaccccacggccgccatcgcccac
agcggcgccctcaccatccgctcgggcgaaaagaccggccgcagtcccgccgacaagcgc
atcgtgcgccaccccaacagcgaggacgacatctggtgggggccgattaacatggagatc
gacgaccacaccttcgagatcaacaaggagcgggcgcaggactacctcaacacccgccag
cgcatctacgtgatggacgggttcgccggctgggacccggcgcaccgcctcaaggtgcgc
atcatttgctcccggccctaccacgccctcttcatgcacaacatgctgatccggccttcc
caggaggagctggcgtccttcggtgagccggatttcgtgatctacaacgcgggcgaattc
ccggccaaccggcagaccaagcacatgagctcgaagacgagcgtggatctgtcgttcgag
aaccaggagatggtcatcctcggcaccgagtacgccggggaaatgaagaagggcgtcttt
acggtgatgcactacctgatgcccaagaaggacgtgctctcgatgcactgctcggcgaac
gagggggacgagggggacgtctcgctcttcttcggcctcagcggcaccggcaagacgacc
ctgtccgccgatccgaaccgcaagctcatcggcgacgacgagcactgctggagcgacgac
ggcgtcttcaacattgaagggggctgctacgccaaggcagtggggctgtccgaggaggag
gagccggagatttacaacgccatccgctacggcaccgtgctcgaaaacatggtctacgac
gaggacacccgggcggtggactacgacgacacctccatcacccaaaacacccgcgcctcc
tatccgctcgactacatcgaccgggccaagattccggggatgggggggcacccggacaac
atcatcttcctcacgtacgacgcgttcggggtgatgccgccagtcagcaagctcacgccc
gagcaggccatgtaccactttatcagcgggtacacggcaaaggtggccggcacggaggtg
ggcgtcgacgagccgcaggccacgttcagcgcctgcttcggcgccgcgttcctcgtgtgg
ccgccggacaagtacgccgaaatgctggccgaaaaaatccgcgcgcacgacgccgaggcg
tggctcgtgaacacgggcatcaccggcggcccgtacggcgtgggccaccgcgtgccgctc
gagcacacccgcgccatgatcgacgccatccacgacggctcgctgctggacgcgccgaag
aagacggagccggtcttcggcctcgacgtgccgaccgagtgccccaacgtgcccaacgac
attttgatgccgcgcgagacgtgggacgatccccaggcctacgacgagaaggccgagcac
ctcgtgggccttttccacgatcacttcgagaaatacgaagacgaggccgccccggcgatt
gccgaggccggtccacagctgcaggcggcgtaa

DBGET integrated database retrieval system