KEGG   Salinigranum rubrum: C2R22_06200Help
Entry
C2R22_06200       CDS       T05289                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
srub  Salinigranum rubrum
Pathway
srub00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:srub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C2R22_06200
Enzymes [BR:srub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C2R22_06200
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C2R22_06200
    1.1.1.-  
     C2R22_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AUV81308
UniProt: A0A2I8VHA4
Position
complement(1262271..1263347)
Genome map
AA seq 358 aa AA seqDB search
MRAAVYYGQKDVRIEDVEPGTVGRGQVRVDVETCGICGTDLHEYAAGPIFIPGEEPHPIS
GEKLPVTMGHEFSGVVSEVGDGVDSLETGDAVAINPILSCGECRQCREGNYHICSSIGFV
GLSGGGGGFSESVVVSEHQAVPLVDGVPIEHGALVEPLAVGLHAVRRAGVQAGDVTAVFG
SGPIGLSVIQSLRAAGAGEIIVSEPRKARRDLAEQSGATTLIDPSDIDAVEEIRDLTDGG
VDQTFEVAGIEATYKQAIQATRPHGTTTIVSIFEEEASSHPIDLVLGERTITGTLAYLGG
PRADEEYGMVIDMLADGTLDVDPLITARIGLDDIVDGGFESLLDPESNQVKILVDPNS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcagtgtactacggtcagaaggacgtacgcatcgaagacgtcgaacccggg
acggtcggtcgggggcaggtgcgggtcgacgtcgagacctgtggcatctgcgggacggac
ctccacgagtacgccgccgggccgatttttattccgggcgaggagccacaccccatctcc
ggagagaagcttcccgtcacgatgggccacgagttcagcggcgtcgtgagcgaggtgggc
gacggcgtcgactcgctcgaaaccggcgatgcggtcgccatcaatcccatcctctcgtgc
ggcgagtgtcggcagtgcagggagggcaactaccacatctgtagctccatcgggttcgtg
ggcctctccgggggagggggcgggttctccgagagcgtcgtcgtgagcgaacaccaggcc
gtcccgctcgtcgacggcgtccccatcgaacacggcgcgctggtcgaaccgctcgccgtc
ggcttacacgccgtccgccgcgccggggtccaggcgggcgacgtcaccgccgtgttcggc
agcggtcccatcggcctgtcggtcatccagtcgctgcgcgccgccggggcgggcgaaatc
atcgtctccgagccccgcaaggcccgccgggacctggcggaacagtccggcgcgacgacg
ctcatcgacccctcagacatcgacgcggtcgaggagattcgcgacctgacggacggcggc
gtcgaccagacgttcgaggtcgcgggcatcgaggcgacgtacaagcaggccatccaagcg
acgcgcccgcacgggacgacgaccatcgtcagcatcttcgaggaggaggcgagttcccac
cccatcgacctcgtgctcggcgaacggaccatcacggggacgctcgcgtacctgggcggg
ccgcgcgcggacgaggagtacgggatggtcatcgacatgctcgccgatggaaccctcgac
gtcgacccgctcatcacggcgcgcatcggcctcgacgacatcgtcgacggcggcttcgag
tcgctcctcgaccccgagagcaaccaggtaaagatcctggtcgaccccaactcctga

DBGET integrated database retrieval system