KEGG   Streptomyces reticuli: TUE45_05033
Entry
TUE45_05033       CDS       T04246                                 

Definition
(GenBank) Xylose isomerase-like TIM barrel
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
srw  Streptomyces reticuli
Pathway
srw00525  Acarbose and validamycin biosynthesis
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    TUE45_05033
Enzymes [BR:srw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     TUE45_05033
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: CUW30307
Position
I:complement(5682633..5683466)
AA seq 277 aa
MTRSPLVGLAGWRLPGDHSAAVGLAHRMGAEGIQLDLGGPGRGPWLDAAGTVDRIRDDCA
RYGVTPLAVAGNTLNDIGLHAPEGSQEALRTRRVLVRVLDAALALGAPLAFVPSFRRSAI
EDLRDLRRTAAVLSWAAREAEARGLLLANENALDPRRARTLVEEVAAPSFRLLLDTYNPR
AAGVDVLALIEAAHAWLAPQVHLKDGTDGTVARELLGDGDGRVWEALAALEARGHLSAAL
VLENDYRDGDLDRLALDVARVRARTARTHDAGTHTRS
NT seq 834 nt   +upstreamnt  +downstreamnt
gtgacgcggtcccccctcgtcgggctcgccggctggcggctgccgggggaccactccgct
gcggtcgggctggcgcaccggatgggcgccgagggaatccagctggacctcggcggtccg
ggcagaggaccctggctcgacgcggcgggaaccgtggaccggatccgggacgactgtgcc
cggtacggggtgacgccgctcgcggtcgcgggcaacacgctcaacgacatcgggctccac
gcgccggagggcagccaggaggcgctgcgcacccgccgggtcctggtccgcgtgctcgac
gcggccctggccctgggcgcgccgctggcgttcgtgccgagcttccgccgcagcgccatc
gaggacctgcgggacctgcggcggaccgcggccgtgctgtcctgggcggcgcgggaggcg
gaggcccgcgggctgctcctcgccaacgagaacgccctggacccgcggcgcgcgcgcacg
ctggtggaggaggtggcggccccctccttccggctgctgctggacacctacaacccgcgc
gcggccggcgtcgacgtcctggcgctcatcgaggcggcccacgcgtggctcgcgccccag
gtccacctcaaggacggcactgacgggaccgtggcccgggaactcctcggggacggggac
ggccgggtgtgggaggcgctcgccgccctggaggcgcggggccacctgtccgcagcactg
gttctggaaaacgactaccgggacggcgacctggaccgtctcgccctcgacgtcgcacgc
gtacgcgcccgcaccgcgcgcacgcacgacgccggcacccacacgaggagttga

DBGET integrated database retrieval system