KEGG   Streptomyces reticuli: TUE45_05567Help
Entry
TUE45_05567       CDS       T04246                                 

Gene name
glpX
Definition
(GenBank) Fructose-1,6-bisphosphatase class 2
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
srw  Streptomyces reticuli
Pathway
srw00010  Glycolysis / Gluconeogenesis
srw00030  Pentose phosphate pathway
srw00051  Fructose and mannose metabolism
srw00680  Methane metabolism
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
srw01120  Microbial metabolism in diverse environments
srw01130  Biosynthesis of antibiotics
srw01200  Carbon metabolism
Module
srw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUE45_05567 (glpX)
   00030 Pentose phosphate pathway
    TUE45_05567 (glpX)
   00051 Fructose and mannose metabolism
    TUE45_05567 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    TUE45_05567 (glpX)
Enzymes [BR:srw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TUE45_05567 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: CUW30832
UniProt: A0A0U5LT35
Position
I:complement(6244130..6245164)
Genome map
AA seq 344 aa AA seqDB search
MTENHHLPSELDVPSEAPDRNLALELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTL
VSTVSMNGVVVIGEGEKDEAPMLFNGEHVGDGTGPEVDIAVDPIDGTTLTAKGMPNAIAV
LAAAERGAMFDPSAVFYMDKLVTGPEAADFVDINAPVEVNIRRIAKAKRSSPEDVTVVIL
DRPRHEGLIREVREAGARIKLISDGDVAGSVYALREGTGVDLLLGIGGTPEGIISACAVK
CLGGTIQGKLWPKDDEERQRAIDAGHDLDRVLTTDDLVSGENVFFVATGITDGELLRGVR
YRSETALTESIVMRSKSGTVRRIDSEHRLRKLRAYSAIDFDRAK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaatcatcatctgccgtccgaactggacgtgccctcagaggctcccgaccgc
aacctcgccctggaactcgtccgggtgaccgaggccgccgccatggcggccggccgctgg
gtcgggcgcggtgacaagaacggcgccgacggtgccgcggtgcgcgccatgcggaccctc
gtctccaccgtctcgatgaacggcgtggtcgtcatcggcgagggcgagaaggacgaggcc
ccgatgctcttcaacggagagcacgtgggcgacggcaccggccccgaggtcgacatcgcc
gtcgacccgatcgacggcaccacgctgacggccaaaggcatgccgaacgcgatcgccgtc
ctcgccgccgccgagcgcggcgcgatgttcgacccgtccgccgtgttctacatggacaag
ctggtcaccggtcccgaggcggcggacttcgtggacatcaacgcgccggtggaggtgaac
atccggcggatcgccaaggccaagcggtcctcgccggaggacgtcaccgtcgtcatcctg
gaccggccccggcacgaggggctgatccgggaggtccgggaggccggcgcgcgcatcaag
ctgatctccgacggcgatgtcgccggctcggtgtacgcgctgcgcgagggcaccggcgtc
gacctgctgctcggcatcggcggtacgccggagggcatcatctcggcctgtgccgtgaag
tgcctgggcgggaccatccagggcaagctgtggcccaaggacgacgaggagcggcagcgg
gcgatcgacgccgggcacgacctggaccgggtgctcaccacggacgacctggtgtccggg
gagaacgtcttcttcgtggcgaccgggatcaccgacggcgagttgctgcgaggggtccgg
taccggtcggagacggcgctgaccgagtcgatcgtgatgcggtcgaagtcggggacggtg
cggaggatcgactccgagcaccggctgaggaagctgcgggcctacagcgcgatcgatttc
gaccgggccaagtag

DBGET integrated database retrieval system