KEGG   Streptomyces reticuli: TUE45_06017Help
Entry
TUE45_06017       CDS       T04246                                 

Gene name
rocA1
Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase 1
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
srw  Streptomyces reticuli
Pathway
srw00250  Alanine, aspartate and glutamate metabolism
srw00330  Arginine and proline metabolism
srw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TUE45_06017 (rocA1)
   00330 Arginine and proline metabolism
    TUE45_06017 (rocA1)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     TUE45_06017 (rocA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh P53_TAD
Motif
Other DBs
NCBI-ProteinID: CUW31279
UniProt: A0A0U5LQ92
Position
I:6751983..6753614
Genome map
AA seq 543 aa AA seqDB search
MDAVTQVPTPVNEPVHGYAPGSPERARLEVKLKELAENPIDLPMTIGGEKRMGGGEPFQV
VQPHNHKSVLGTGRHATQQDARDAIDAALAAAPAWRAMSFDDRAAIILRAAELLAGPWRE
TIAASTMLGQSKTAQQAEIDTPCELVDFWRFNVHYARQILAEQPPANSPGVWNRLDHRPL
EGFVYAITPFNFSAIAGNLPTAPALMGNVVVWKPSPTQTHAAVLLMQLLEEAGLPKGVIN
LVTGDGIEVSKVALEHRDLAGIHFTGSTKTFQYLWKTVGNNIEKYRSYPRLVGETGGKDF
LVAHPSADRAILKTALTRGAFEYQGQKCSATSRAYIPASIWNSGFKEEFAAEVDYLTMGD
VTDLSNFIGAVIDDRAFAKNKAAIDRAKQDPTCTIVAGGSYDDSVGYFVRPTVIECTDPE
NEVFTTEYFGPILAVYVYEDDKYDEMLTQMESVSDYALTGSVIANDRAAAAYTMEKLRFA
AGNFYINDKSTGAVVGQQPFGGGRASGTNDKAGAPQNLQRWTLTRAIKETLVPPTDYTYP
HMG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgtgacccaggtccccacccccgtcaacgagccggtgcacggctacgccccc
ggctcgcccgagcgtgcccggctggaggtcaagctcaaggagctggccgagaacccgatc
gacctgccgatgaccatcggcggcgagaagcggatgggcggcggcgagccgttccaggtg
gtccagccgcacaaccacaagtccgtcctcggcaccggccgccacgccacccagcaggac
gcccgggacgccatcgacgcggccctggccgccgcgccggcctggcgcgcgatgtccttc
gacgaccgcgccgcgatcatcctgcgcgccgccgagctgctggccggcccgtggcgcgag
acgatcgccgcctccaccatgctgggccagtccaagaccgcccagcaggcggagatcgac
acgccgtgcgagctggtcgacttctggcgtttcaacgtccactacgcccgccagatcctg
gccgagcagcccccggcgaactccccgggcgtgtggaaccggctggaccaccgcccgctg
gagggcttcgtctacgcgatcacgccgttcaacttctcggcgatcgccggcaacctgccc
accgcccccgccctgatgggcaacgtggtggtctggaagccgtccccgacccagacccac
gcggccgtcctcctcatgcagctgctggaggaggcgggcctgcccaagggcgtcatcaac
ctcgtcaccggcgacggcatcgaggtctccaaggtcgccctggagcaccgggacctcgcg
ggcatccacttcaccggttcgaccaagaccttccagtacctgtggaagacggtcggcaac
aacatcgagaagtaccgctcctacccgcgtctggtcggcgagaccggcggcaaggacttc
ctcgtcgcccacccctcggccgaccgcgccatcctgaagacggccctcacccggggcgcc
ttcgagtaccagggccagaagtgcagcgccacctcccgcgcctacatcccggcctccatc
tggaactcgggcttcaaggaggagttcgcggccgaggtcgactacctgaccatgggtgac
gtcaccgacctgtcgaacttcatcggcgccgtcatcgacgaccgcgcgttcgccaagaac
aaggccgcgatcgaccgcgccaagcaggacccgacctgcaccatcgtcgcgggcggcagc
tacgacgactcggtcggctacttcgtccgcccgaccgtcatcgagtgcaccgacccggag
aacgaggtcttcaccaccgagtacttcggcccgatcctcgcggtgtacgtctacgaggac
gacaagtacgacgagatgctgacccagatggagtcggtctccgactacgccctgaccggc
tcggtcatcgccaacgaccgtgccgccgcggcctacacgatggagaagctccgcttcgcc
gcgggcaacttctacatcaacgacaagtcgaccggcgccgtcgtcggccagcagcccttc
ggcggcggccgggcctccggcaccaacgacaaggccggcgccccccagaacctccagcgc
tggaccctgacccgcgccatcaaggagaccctggtcccgccgaccgactacacctacccg
cacatgggctga

DBGET integrated database retrieval system