KEGG   Streptomyces reticuli: TUE45_06409Help
Entry
TUE45_06409       CDS       T04246                                 

Gene name
asnO_5
Definition
(GenBank) L-asparagine oxygenase
  KO
K18058  L-asparagine oxygenase [EC:1.14.11.39]
Organism
srw  Streptomyces reticuli
Brite
KEGG Orthology (KO) [BR:srw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TUE45_06409 (asnO_5)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.39  L-asparagine hydroxylase
     TUE45_06409 (asnO_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauD CsiD
Motif
Other DBs
NCBI-ProteinID: CUW31660
UniProt: A0A0U5LXN0
Position
I:complement(7233101..7234081)
Genome map
AA seq 326 aa AA seqDB search
MTTTASDAQPGVLTTGADDRLLTERLAGWLADRPGAAVDDPAWLAAVRRAWPELPAGLIT
GLREFRRDSGPTGTLLIRGLPIGEEGLPPTPSRPGSVQREATVSAAVLTLVASCLGDPGA
FRAEKSGAIVQDVVPVPGKEEDQSNAGSVLLSFHTENAFHPHRPDFVLLLCLRADHEQVA
ELRTTCVRQVLPLLTEESREALFRAEFVTAPPPSFGAHDGGTEPRAVLYGAAEDPDLCVD
LAATEPLTERGRAALDELGGLFERRAQGLRLLPGDLAIVDNRVTVHGRSSFRPRYDGLDR
WLQRTFVFTDLRRSRGCRRDDGHVLD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacagcgagtgatgcgcagccgggcgtcctcaccacaggcgccgacgacagg
ctgctgacggagcgtctggccggctggctggccgaccggccgggcgccgccgtggacgac
ccggcgtggctggccgccgtccggcgggcctggccggaacttccggccgggctcatcacc
ggcctgcgggagttccgtcgtgactccggcccgaccggcaccctgctcatccggggactg
ccgatcggtgaggagggcctgccgcccacaccgtcccggccgggttccgtgcagcgggag
gccaccgtgagcgcggcggtgttgacactggtcgccagctgtctcggcgatccgggggcg
ttccgggcggagaagagcggcgcgatcgtccaggacgtcgtccccgtgccgggcaaggag
gaggaccagagcaacgcgggctccgtgctgctcagcttccacacggagaacgccttccac
ccgcaccggccggacttcgtgctgctgctgtgcctgcgggccgaccacgagcaggtggcc
gagctgcgcaccacctgtgtccggcaggtccttccgctgctgacggaggagtcgcgggag
gccctgttccgcgcggagttcgtcaccgcgccgccgccgtcgttcggcgcgcacgacggc
ggtacggagccgcgcgcggtgctgtacggggccgctgaggacccggacctgtgcgtcgac
ctggcggccaccgagccgctgacggagcgcggccgggcggccctggacgagctgggcggg
ctcttcgagcgcagggcgcagggcctgcggctgctcccgggcgatctggcgatcgtggac
aaccgggtcaccgtgcacggccggtcctcgttccggccccgctacgacggcctggaccgc
tggttgcagcgcaccttcgtcttcaccgacctgcgccgctcgcgcggctgccggcgggac
gacggccacgtgctggactga

DBGET integrated database retrieval system