KEGG   Streptomyces reticuli: TUE45_07208Help
Entry
TUE45_07208       CDS       T04246                                 

Gene name
zwf_2
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
srw  Streptomyces reticuli
Pathway
srw00030  Pentose phosphate pathway
srw00480  Glutathione metabolism
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
srw01120  Microbial metabolism in diverse environments
srw01200  Carbon metabolism
Module
srw_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
srw_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TUE45_07208 (zwf_2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TUE45_07208 (zwf_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srw04147]
    TUE45_07208 (zwf_2)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     TUE45_07208 (zwf_2)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     TUE45_07208 (zwf_2)
Exosome [BR:srw04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TUE45_07208 (zwf_2)
  Exosomal proteins of colorectal cancer cells
   TUE45_07208 (zwf_2)
  Exosomal proteins of bladder cancer cells
   TUE45_07208 (zwf_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: CUW32458
Position
I:complement(8167764..8169350)
Genome map
AA seq 528 aa AA seqDB search
MTENAPAAQAPGEVRVPVVPAADWVNPLRDARDRRLPRIAGPSGLVIFGVTGDLSRKKLM
PAVYDLANRGLLPPGFSLVGFARREWEDQDFAQVVHDSVREHARTPFREEVWQQLAEGMR
FIPGDFDDDTAFKQLKDAVEELDASRGTGGNFAFYLSVPPKFFPKVVQQLKKHGLAAPPE
GSWRRAVIEKPFGHDLNSARELNAIVHEVFEPDQVFRIDHYLGKETVQNILALRFANQMY
EPIWNRSYVDHVQITMAEDIGIGGRAGYYDGIGAARDVIQNHLLQLMALTAMEEPIAFDA
DALLTEKLKVLKSVRLPEDLGRHTVRGQYAAGWQGGEKVIGYLQEEGIDPKSKTDTFAAI
KLGIDNRRWAGVPFYLRTGKRLGRRVTEIAVVFKRAPHSPFDSTATEELGQNAIVIRVQP
DEGMTVRFGSKVPGTSMEIRDVSMDFAYGESFTESSPEAYERLILDVLLGDANLFPRHQE
VEESWKILDPIEEYWAAHGRPAQYASGSWGPREADEMLARDGRSWRRP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaacgcccccgccgcccaggcacccggggaggtgcgcgtgccggtcgtcccg
gccgccgactgggtgaacccgctgcgggacgcccgcgaccgccggctgccccgcatcgcc
ggtccgtcgggtctggtcatcttcggggtgaccggtgacctgtcccgcaagaagctgatg
ccggccgtgtacgacctcgccaaccgcggtctgctgccgccgggcttctccctcgtcggg
ttcgcccgccgcgagtgggaggaccaggacttcgcgcaggtcgtccacgactccgtccgc
gagcacgcccgcaccccgttccgcgaggaggtgtggcagcagctcgccgagggcatgcgg
ttcatccccggcgacttcgacgacgacaccgccttcaagcagctgaaggacgccgtcgag
gagctggacgcctcccgcggcaccggcggcaacttcgccttctacctctcggtgccgccg
aagttcttcccgaaggtcgtgcagcagctgaagaagcacggcctggccgccccgccggag
ggctcctggcgccgcgcggtcatcgagaagccgttcgggcacgacctgaacagcgcgcgc
gagctgaacgcgatcgtgcacgaggtgttcgagccggaccaggtgttccgcatcgaccac
tacctcggcaaggagaccgtccagaacatcctggcgctgcgcttcgccaaccagatgtac
gagccgatctggaaccggtcgtacgtcgaccacgtgcagatcacgatggccgaggacatc
ggcatcggcggccgggccggctactacgacggcatcggcgccgcccgggacgtcatccag
aaccacctgctccagctgatggcgctgaccgcgatggaggagcccatcgcgttcgacgcg
gacgcgctgctcaccgagaagctgaaggtgctgaagtcggtgcggctgccggaggatctc
ggccggcacaccgtgcgcggccagtacgcggcgggctggcagggcggcgagaaggtcatc
ggctacctccaggaggagggcatcgaccccaagtcgaagaccgacaccttcgccgcgatc
aagctgggcatcgacaaccgccgctgggcgggcgtccccttctacctgcgcaccggcaag
cgcctgggccgccgggtcaccgagatcgcggtggtcttcaagcgggccccgcactccccg
ttcgactccaccgccaccgaggaactgggccagaacgccatcgtcatccgcgtccagccg
gacgagggcatgaccgtccgcttcggctccaaggtgccgggcacctcgatggagatccgg
gacgtgtccatggacttcgcctacggcgagtcgttcacggagtcgagtcccgaggcgtac
gagcggctcatcctggacgtactcctcggcgacgccaatttgttcccccgtcaccaggaa
gtggaagagtcctggaagatcctcgacccgatcgaggagtactgggcggcgcacggcagg
ccggcgcagtacgcgtcgggcagctggggaccgcgggaagccgacgagatgctcgcacga
gacggacggagctggcgcaggccatga

DBGET integrated database retrieval system