KEGG   Sinocyclocheilus rhinocerous: 107707872Help
Entry
107707872         CDS       T04916                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00071  Fatty acid degradation
srx01212  Fatty acid metabolism
srx03320  PPAR signaling pathway
srx04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107707872
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107707872
   03320 PPAR signaling pathway
    107707872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:srx03029]
    107707872
Enzymes [BR:srx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107707872
Mitochondrial biogenesis [BR:srx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107707872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107707872
NCBI-ProteinID: XP_016367466
Position
Unknown
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVGPDGIDLQLSHEALRQVYLSGLHSWKKKFIRFKNGILNGVYPGSAP
GFVLVLAGYLGRAHYLKVDPSLGLLVKLCKLVPVSRYMSTQNQMLVGGVMVGTGLWIAII
FSMRTVLKGLLSWHGWMFAPHGKITCQLRIWLILVKFFSGMQTPMLYSFQNSLPHLPVPS
VKDTMSRYLESVRPLLSDEEHQRMQSLALGFEKNLGPKLQWYLKLKSWWATNYVSDWWEE
YIYLRGRGPIMVNSNYYVMDFLYAFPTHLQAARTGNVIHAIMIYRRNLDRAQMKPLMLQN
TIPMCSSQYERMFNTSRIPGIETDTVQHMSDSRHIVVYHRGRYFKVGMFYDGRLLLPREI
EQQMERILADTSEPQPGEETLAALTAGDRVPWACARNAYLRHGKNKKSLDAVEKAAFFVT
LDDTEQRYDPANPVESLDCYAKSLLHGKCYDRWFDKSINLIVFKNGTIGLNAEHSWADAP
IVGHLWEQVLSMDPVKLGYTAEGHCKGETHHNLPGPQRLQWNIPPECQTMIANSLSVAVA
LADDVDSHIIPFSDFGKGLIKKCKISPDAFIQLALQLAHYRDKGKFCLTYEASMTRLFRE
GRTETVRSCTIESCAFVRAMINNKTREEKLRLLTQAAGKHQQMYRLAMTGQGIDRHLFCL
YVVSKYLGQDSPFLQEVLSEPWKLSTSQTPLQQGELFDLVNHPEYVTSGGGFGPVADDGY
GVAYVIIGEKLINFHISSKRSSPETDSHRFGNNIRQAMLEMLDLFQLDKKDLK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcatcaggctgtggcctttcagttcactgtcggccctgatggcattgac
cttcagctcagtcatgaggcccttcggcaggtctacctctccggacttcactcctggaag
aagaaattcattcgctttaagaatgggattttgaatggggtttacccaggaagtgcacca
gggttcgtgctggtgttggcagggtacttgggaagagcacattatttaaaagtggaccct
tccttaggcctgctcgtcaaactttgcaaacttgtcccagtcagtaggtacatgtctaca
caaaatcagatgttagttggaggtgtcatggtgggcacgggtctgtggattgccatcata
ttcagcatgaggactgtcctgaagggtctgctgtcctggcacggctggatgtttgctccc
catggcaaaataacctgtcaacttcggatatggctgatcctagtgaagtttttttctggc
atgcaaacaccaatgctatacagcttccagaactctctccctcatttacctgtgccatct
gtgaaggacaccatgagtagatatcttgaatcagttcggccactgctgagcgatgaggaa
catcaaagaatgcagagtcttgcgcttggttttgagaagaaccttggaccaaaacttcag
tggtacctcaagctgaagtcttggtgggccaccaattatgtcagtgactggtgggaagaa
tatatctacttgagaggtcgtgggccaatcatggttaacagcaactattatgtaatggac
tttctttacgcctttcctacacatctgcaagcagcaagaaccggcaacgtcattcatgca
atcatgatttacaggaggaatctggaccgggctcaaatgaagccgttaatgcttcagaac
accatccctatgtgctcctcccagtatgagcgtatgttcaacaccagtcgcatcccaggc
atagaaacagacacagttcagcacatgtctgacagcaggcatattgtggtgtatcaccga
ggccgttactttaaagtggggatgttttatgatgggcggttactgttgccacgggagata
gagcagcagatggagaggattctggctgacacgtcagagccacagcctggagaggaaacc
ctcgctgccctcaccgcaggggacagagtgccttgggcgtgtgcccgtaatgcctacctc
agacacggcaagaacaagaagtctctggatgctgtggaaaaggccgctttctttgttaca
ctggatgacacagagcagcgctatgacccagcaaaccctgtggagtccctggactgttac
gctaaatcgctgctccacgggaagtgttatgaccggtggtttgataagtccataaactta
attgtcttcaagaatggaaccataggccttaatgcagaacatagctgggccgatgctcct
atcgttggccacctctgggagcaagtgctctcgatggacccagttaagctaggctacaca
gcagagggccactgtaaaggagaaactcaccataatcttcctggacctcaaagactccag
tggaatatcccacctgagtgccaaactatgattgccaactctttgtctgtggctgtggct
ttggctgatgatgtggactctcacatcatccccttcagtgactttgggaaaggcctgatc
aagaagtgcaagatcagtcctgatgccttcatccagcttgcactgcagctggcccattat
agggacaaaggaaagttttgcctgacttatgaggcatccatgacacgtttattcagagaa
ggccgtacagaaactgtgcgctcctgcaccatagaatcctgtgcttttgtccgtgccatg
atcaacaacaaaacgagagaagagaaacttcgtttactaacccaggccgctgggaaacac
cagcagatgtataggctggcaatgaccggtcagggcattgaccgccatctcttttgcctc
tacgtagtgtctaagtaccttggacaggactccccattcctccaagaggtgttgtcagag
ccttggaaactctccactagtcagactcctttgcagcagggggagctgtttgatctggtg
aatcacccagagtatgtgaccagtggaggaggctttggaccggttgcagatgacggttat
ggtgtggcctatgtgattatcggtgaaaaactcatcaatttccacatctcttccaagcgt
tctagtccagagacggactctcatcgctttggaaacaatatcaggcaagcaatgcttgaa
atgctggatctgtttcagcttgacaaaaaggacctaaagtga

DBGET integrated database retrieval system