KEGG   Sinocyclocheilus rhinocerous: 107708257Help
Entry
107708257         CDS       T04916                                 

Gene name
acox3
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00071  Fatty acid degradation
srx00592  alpha-Linolenic acid metabolism
srx01040  Biosynthesis of unsaturated fatty acids
srx01100  Metabolic pathways
srx01212  Fatty acid metabolism
srx03320  PPAR signaling pathway
srx04146  Peroxisome
Module
srx_M00087  beta-Oxidation
srx_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107708257 (acox3)
   00592 alpha-Linolenic acid metabolism
    107708257 (acox3)
   01040 Biosynthesis of unsaturated fatty acids
    107708257 (acox3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107708257 (acox3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107708257 (acox3)
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107708257 (acox3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 107708257
NCBI-ProteinID: XP_016367962
Position
Unknown
AA seq 708 aa AA seqDB search
MSAPAIKDAKYVLGEKMDEGIPDFPSGPLAIYRKKASFSWKEMLQFLEGDEIIAFKQHVF
RTLERDPLFARQPGENIPVEQKRELTFRRCKQLFKYDFVTRDDVMQNPWKMTILSDCLGM
YDWSLGAKYFLNKGMFGATVANTGSQRHLMFVQDIEQMMTFGCFALTELSHGSNTRAMRT
TARYDPSTQEFVINSPDFEAAKFWVGNLGKTATHSVVFAQLYTPDGQCHGLHSFIVQVRD
PKTLLAMPGVMVGDMGKKLGQNGLDNGFVVFHSVRIPRENLLNKTGDVTPDGRYVSPFKD
PNKRFGASLGALSGGRVGITRMALVNLKLAVTVAVRFSATRRQFGPKEDEEIPVLEYQLQ
QWRLIPFLAAVYALEHFTRPLCMNFVEFQIGLLMKDKSDRQAELGREIHAMSCASKPLGS
WTAQRGIQECREACGGHGYLAMNRLGDLRDDNDPNCTYEGDNNVLLQQTSNYLLSWLQHK
QQGKGRIESPLETVNFLEDMKSILQSKFTVGSVEECMNSGVPLAAYKWLVCFLLGESQRK
LFHEKSSGLGDFEARNNSQVYYCRSLAIAYIEHTVLQRFHDLIQDEQTPAALRSVLGRLC
ALYGLWTLTNHMAILYQGGYFSGRQPVDFIHTAILTLCGQLKDDAVALVDVIAPPDFILN
SPIGKADGELYKNLWSTVMQGKSVLERPSWWAEFCSDKPAVGSLRAKL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgccagccatcaaagatgctaaatacgttttgggagagaaaatggatgagggc
atcccagactttcccagtggtccactagctatctacaggaagaaagcatccttcagctgg
aaggaaatgttgcagtttctggagggcgatgaaatcattgcattcaagcagcacgtgttc
agaacactggagagggacccgctctttgcacggcagcctggtgagaacatcccagtggag
cagaagcgagagctcaccttccgccgctgtaaacagttatttaagtatgactttgtaaca
cgtgatgacgtcatgcagaacccctggaagatgacaattctcagtgactgcctgggaatg
tatgactggtctttgggagccaaatacttccttaacaaagggatgtttggagccacagtg
gcaaacacaggatctcagagacacttgatgtttgtgcaggacattgagcaaatgatgaca
tttggatgctttgcactgacagagctgagccatggcagcaacacgagagctatgaggaca
acagccagatatgaccccagcactcaggagtttgtgattaactctccagactttgaagca
gccaagttctgggtggggaacttgggaaagacggccactcattcagtcgtatttgcacag
ctctacacccctgatgggcaatgccacggccttcactcttttatagtccaagtcagagat
ccaaagaccttgctggcaatgccaggagtgatggtcggggatatgggaaagaaactgggt
cagaacggactggataacggttttgtcgtattccacagtgtgaggatacctcgggaaaac
ttgctaaacaaaacaggagatgttacgcctgacggacgctacgtttcaccttttaaagac
cccaataagcggtttggggcatctttaggggctctgtcaggaggcagggtgggcattaca
aggatggcactggtcaatctgaagcttgcggtgactgtggctgtgcgattctccgccaca
cgcagacagttcggacccaaagaggacgaggagattccagtgctggaatatcagctacag
caatggcgtcttattccgttcctggcagcggtgtacgcactggagcacttcaccagaccc
ctctgcatgaactttgtggaatttcaaattggactgttaatgaaggacaaaagcgacaga
caggctgaactgggcagagagatccatgccatgtcgtgcgctagtaaacctctggggtca
tggacagcccagcgaggcattcaggaatgccgagaggcttgtggaggacatggttacctc
gccatgaaccggctgggagatctgcgtgatgacaacgacccaaactgcacatatgagggt
gataacaacgtccttctgcagcagaccagcaactatctgctcagctggcttcaacacaaa
cagcaaggtaaaggaaggattgaatcccctcttgagactgtgaactttttagaggacatg
aagagcattctgcagagcaagttcacagttggctcagtggaagagtgcatgaactcaggc
gtgcctctggcagcatataagtggctggtgtgtttcttgctgggtgagagccagaggaag
ctgtttcatgagaaatcctctggactgggagactttgaggcacgaaacaacagccaagtg
tattattgtcgctcattggcaattgcctatattgagcacacagtgctgcagcgtttccat
gatctgattcaggatgaacagactccagctgctctcagatcagtgctggggcgtctctgt
gctctctatggcctgtggaccctcaccaaccacatggccatcctgtatcaaggaggttat
ttttctggtcgacagccggttgacttcatccacacagccattctcactctgtgtgggcag
ctgaaggatgatgctgtggcgctggttgatgtgattgctcctcctgacttcatcctgaac
tcacccattggcaaagcagatggtgagctctacaaaaacctgtggtctacagtcatgcag
ggtaagagcgtcctggaacggccatcttggtgggccgagttttgttctgacaaacctgcg
gttggatctctccgagccaaactgtaa

DBGET integrated database retrieval system