KEGG   Sinocyclocheilus rhinocerous: 107708576Help
Entry
107708576         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107708576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107708576
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107708576
Protein kinases [BR:srx01001]
 Serine/threonine kinases: STE group
  STE20 family
   107708576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo RIO1 FTA2 Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107708576
NCBI-ProteinID: XP_016368324
Position
Unknown
AA seq 248 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEDEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNSLQEYWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENSEATYDYRVRACLEHLYCCNIVLLFRPYCRNLSLP
HTSVSPTL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccagcgaaaagtctagtagacatagacctttcttcactacgggac
ccagccgggatttttgaactggtcgaagtggttggaaatggtacatatggtcaagtgtac
aagggtcgacatgtcaaaacaggacagctggcggcaatcaaagtcatggatgtcacagag
gatgaggaggatgagattaaacttgagattaacatgctgaagaaatactcccaccacaga
aacattgccacatactatggtgcttttatcaagaagagtcctcctggacatgatgaccag
ctgtggttggtcatggagttttgtggtgctggatctataacagaccttgttaagaacacc
aaaggcaacagtttgcaagaatactggattgcatacatctccagagagattctgagaggt
ctggcccatttgcatgcccaccatgtcatccatcgtgacattaagggtcagaatgtgctg
ttaacagagaatgccgaggtgaaattagttgactttggtgtgagtgctcagttggacagg
acagttggcagaagaaacactttcattggcactccttattggatggcgccagaggtcatt
gcctgtgatgagaactcagaagcgacatatgactatagagtaagagcctgtcttgaacat
ttatactgttgtaatatagtccttcttttcagaccttactgtagaaatctttctctgccc
catacatctgtgtccccaacattgtag

DBGET integrated database retrieval system