KEGG   Sinocyclocheilus rhinocerous: 107708751
Entry
107708751         CDS       T04916                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:srx01002]
    107708751
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107708751
Peptidases and inhibitors [BR:srx01002]
 Metallo peptidases
  Family M1
   107708751
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N ERAP1_C DUF5700
Other DBs
NCBI-GeneID: 107708751
NCBI-ProteinID: XP_016368537
Position
Unknown
AA seq 758 aa
MLLAQSCCLSCFTFAILFCGLFVGNHGMTVNTDTNASPFPWDKIRLPETVKPQHYDLLIH
PNLTSLTFTGVVQILIEVEQDTRAIILHSKNLQISKAQLLGSRHPQDLQTSEFEAYEQIA
LFSDGFSFEKGNHVVHLEFSANLSDSFHGFYKGRYTTNSGEVRMLASTQFEATHARAAFP
CFDEPAFKANFTIRVRRESRHISISNMPKLRTAELADGLLEDQFDTTVKMSTYLVAFIIC
DFQSISKTSQHGIEISVYTVPEKISQAEYALNTAVTLLDFYDDYFDIPYPLPKHDLAAIP
DFQSGAMENWGLSTYRESGLLFDPEKSSSSDKLGITKVIAHELAHQWFGNLVTMQWWNDL
WLNEGFAKFMEYVSVNITHPELQVDDYFLEKCFTAMSVDSLTSSHPISTPVENPAEISEM
FDDVSYRKGACILNMLRDFLTPEAFKAGIIHYLKSHSYQNTVNAHLWESLTNICTSDELD
SGRLKHDGFCSKFRAKSPASKWFMEDSVDVRAIMDTWTLQEGFPLITVEVKGQEVTLKQE
RFLREANTSKTTNTSSFLWQVPLTYITSHSSAVQRFLLKSEKDVLYLPEKVDWIKFNVDL
RGYYIVHYESRGWDALINQLQQNHSVFSSNDRASLIHDIFQLVSIEKVPLDKALNLSLYL
SKESEIMPVTQGFNELVPFYKLMEKRNMEELENQLKNHLVKIFKTLIDRQSWSDDGSVSE
RMLRNYLLLFACVRRYPSCISTATRLFQQWKESDGKMR
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgctcctcgcccagtcttgctgtttaagctgctttacatttgcaattttattctgtggt
ctttttgttggaaaccatggaatgactgtcaacacagacacaaatgcatcgccttttccc
tgggacaagataagattgccagaaacagtgaagccccagcactatgacctcttgatacac
cccaacttgacctccctgaccttcaccggagtggtccagattctcatagaggtagagcag
gacaccagagccatcatccttcacagcaagaacctgcagatctccaaagctcagctcttg
ggctccagacatcctcaggatctgcaaaccagtgagtttgaagcctatgaacagatcgcg
ctcttctctgatggcttctcatttgagaaaggaaaccatgtggtgcatttggagttctct
gccaacttatcagatagttttcatggcttttataaaggcagatataccacaaacagtgga
gaggtcaggatgttggcatccactcagtttgaggcgacacatgctcgagctgccttccct
tgttttgatgaacctgcattcaaagccaactttaccatccgtgtgcgcagagaatcaagg
cacatttccatatccaacatgcccaagctgagaactgcagaactggctgacgggctgctg
gaggatcagtttgacacgacggtgaagatgagcacctacctggtggccttcatcatctgc
gatttccagtccatcagtaaaacaagccagcatggaatcgagatatcagtgtatacggtt
cctgagaagatcagtcaggcggaatatgctctcaacaccgccgtcactctgctcgacttt
tatgatgattattttgacatcccgtatccacttcccaaacacgatcttgcggcgatccca
gatttccagtcaggcgctatggagaattggggcctgtcgacttacagagagtccggtttg
ctctttgaccctgagaaatcttcttcctcggacaaactgggaatcaccaaagtcatcgcc
cacgagctagcacatcagtggtttggaaacctggtcacgatgcagtggtggaacgacctg
tggttaaacgagggctttgccaagttcatggagtatgtgtctgtcaacatcacccaccct
gagctgcaagtggatgattatttcctggagaagtgcttcaccgccatgtctgtggactct
ttaacctcctcacaccccatttccactccagtagagaatccagcggagatcagcgagatg
tttgatgacgtttcctaccggaagggagcatgtatcctgaacatgctgagggatttcctg
accccagaggctttcaaggccggtattatacactacctgaagagtcacagctaccagaac
acagtgaacgctcacctctgggaaagtcttaccaatatctgcacttctgatgaattggat
tcagggagattaaaacatgatggattctgttccaaattcagggctaaatctccggcctct
aaatggttcatggaggatagtgttgatgttcgagccattatggacacctggacgctgcag
gaggggtttcctttaatcactgtggaggtcaaaggtcaagaggtcaccctcaaacaggag
cgcttccttagagaagcaaacacttcgaagactacaaatacatcaagcttcctgtggcag
gttcctctgacttacatcaccagtcacagtagtgcagtgcagcgttttttgctgaaaagt
gaaaaagatgtgttgtacctgccagagaaggtggactggattaaattcaacgtggacctg
cgggggtattatattgtacattatgagtcgagaggctgggatgctttgatcaaccaactc
cagcagaaccacagtgtgttcagcagcaacgacagagccagtctgatccacgacatcttt
cagctggtcagcattgagaaagtcccgctggataaagctctgaatctgagtttgtacctc
agtaaagagtcggagatcatgccggtgacgcagggctttaatgagctggtgcccttttac
aaactcatggagaagagaaacatggaggaactggagaaccagctgaagaatcatttagtg
aagatattcaagacgctgattgaccgtcagagctggtctgatgacgggtctgtatccgag
cggatgctcaggaattatctgctgttgtttgcctgtgtccgtcgttacccatcctgcatc
agcaccgccactcgactcttccagcagtggaaagaatccgatggcaaaatgcggtga

DBGET integrated database retrieval system