KEGG   Sinocyclocheilus rhinocerous: 107712257
Entry
107712257         CDS       T04916                                 

Definition
(RefSeq) AF4/FMR2 family member 3-like
  KO
K15195  AF4/FMR2 family member 3
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:srx03021]
    107712257
Transcription machinery [BR:srx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107712257
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int Lenti_VIF_2
Other DBs
NCBI-GeneID: 107712257
NCBI-ProteinID: XP_016372926
Position
Unknown
AA seq 1223 aa
MPTIYGSKGKLASVCFMLQHASQDMTQSWPYQQPPGEGGTHHFLYSHSKEGKQPNSRHRH
VRDGVSMRMPSRPLVAPHKSMLADDLKLSSDEDDKDEGSEQTTSWADNDRLSGQQQHRTN
THVGRVRHSSSGSSGSDPSSEWESSSQRSRSPSPGTHNRCGTPTQQRTLICSTETESPPS
TQWQLDRWLEKVPKNNPSTDHDPDGGQRRSVKSDCGRGPSPGRYWSRDFESRRDYSPCES
PVPSPKFDYSPHPSPEYSPCPSPGISLVPSPVPSVCPSPGDSLQGSRSPSPLPLHPPRSP
SPSLLSTAVPSQGTYPQVQPPQKESPRHIARPTVTSNPAHRPKVRPWVPPDHSANQRTEF
RPKDSRSRDSRSKDSRPGPPHQPHHSEHSSTEKSHKDLTHKLEAKNSETTSKQRFNSPSN
PISKHSSKQRPSVSPKPQARHSSTTDHSIEHSHRSNEPTGVSIHSSHSKSGHSSHFNTLK
SSDRGPSSKSRDSSRSEVNSRSSYSSKTKSFPDTKQSSSKQTSQQSSSPKPKVKLGDAPV
PRTGHFQKDTKPREREREVGNRGKAQGATLVQTSKEQRQRLAQEQVIRRRWVRSSEEEED
EEDRRTEEGERERKRRRRREQEVEWKAVQPKQRPHTNSQHHAQKEYNGFNLEEQRRKKRR
WSNEDISSGPHVTDTSLSPPLSPPSPTPVIKPTHPSSSSSSSSSSSSSSSSESDSESSPP
QNVAKVPADSTSNQKAVSKRRHDKQTSGTGAQPHGSSISTPEIDKQGRGRHKLYTLVPFG
RTEKSPTVAHRGLKKLVVRIDLSLLGRVPSADEITEGQSSSSALSSGKAKEKTSMKHLHR
LDQLPGDGRSKRKAENGDAQRENKRNQSRADKLPVSVHNETEETFNKQNGCQDDYFYSKR
PVSPLSPPSGILELSKPSVKAQHAEKYHTPPEKDKDSTAQKKQDQKMQPKVEVECVRVSG
HLQSLSGSLVPPSNLPLHYRGTVPISDVSHHAEYYMHEAKRLKHRADAMVDKLGKAVNYV
DAALSFMECGKAMEEGPLESKSPYTMYAETVELIRYAMRLKSNAGPGASQEDKQLAVLCF
RCLALLYWQMFRLKKDNALKYSKVLLDYFKSSPKGPHNPPPWNDAGKGTVPPASICSGSS
QSSVISIPHRIHQMAANHLNITNRVLYCYEYWEVADTLAKENKEFFNYLNTLTGPLTLHS
SMAHIVQYTRQGLQWIRISANLS
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgcctaccatttatggaagtaagggaaaacttgcaagtgtttgtttcatgcttcagcac
gcatcccaggacatgacccaatcctggccttaccagcaacccccaggggaagggggcact
catcatttcctgtactcacactcaaaggagggaaaacagcccaattcacgacacagacat
gtgagggatggtgtctctatgaggatgccctcacgtccactcgtggcccctcataaatcc
atgctcgctgatgacctgaagctcagcagtgacgaagatgacaaggacgagggaagtgag
caaacaacttcctgggctgataatgaccgcttgtcaggccagcagcagcaccgcacaaac
acacacgtcggaagagtgagacattctagctcagggtcttcaggatcagacccgtccagt
gagtgggagagcagcagccagcggtcacgcagcccgagcccagggacgcacaaccggtgc
gggacaccgacccaacagcggaccctaatctgcagcacagagacggagagtccaccatcc
acacagtggcagctggacaggtggcttgagaaagtcccaaaaaataatccttcaactgac
cacgacccagatggaggacagcgacggagtgtgaaatctgactgtggccgaggaccatca
cctggaagatactggagcagagactttgagtccagacgggattacagtccatgtgaaagt
ccggtcccaagtccaaaatttgactacagtcctcatcccagcccagaatacagtccatgc
cccagtccaggaattagccttgtgccgagcccagtgccaagtgtgtgcccaagtccagga
gacagcctccaagggagtcgaagtcccagccctttacctttacaccctcccagaagcccc
agtccaagtcttttatccaccgcagtacctagccaaggtacatatcctcaggtacagcca
cctcaaaaagaaagtcccaggcatattgctaggccaaccgttacctctaatccagcacat
cgtcccaaagtaaggccatgggtgcctccggaccatagtgccaaccagagaacggagttt
agacccaaagactctagatccagagactctcgatccaaagactccagacctggtcctccc
catcaaccccatcattccgaacacagctcaacagaaaagtcacacaaagatctcacacac
aaacttgaagccaaaaactctgaaaccacaagcaagcaaaggtttaactcaccttcaaac
cccatttcaaagcattcgtcaaagcaaagaccaagcgttagcccaaaaccacaagccaga
cactcatctacaactgaccatagtattgaacacagtcacagaagcaatgaacctacagga
gtgtcaatccacagttcacactccaaatcaggccattcatctcattttaatactctaaag
agttccgaccgtggtccctcgtcaaagtccagggactcatcccgaagcgaagtcaacagt
cgatctagttacagctcgaagactaaatctttcccagatacaaagcagtccagctctaaa
cagacttcccaacagagttccagcccaaagcccaaggtcaaactaggggatgccccagtg
cccagaaccgggcatttccaaaaagacacaaagcccagagagagagagcgagaggtgggc
aaccgaggtaaggcccagggagcaaccctggtgcagaccagcaaggagcagagacaaaga
ctggcgcaggagcaagtaataaggcgtcgctgggttcggagttctgaggaagaggaagac
gaggaagataggagaaccgaggaaggggaaagagagaggaagcggaggaggaggagggag
caggaagttgaatggaaggcagtgcagcccaagcaaagacctcacaccaacagccagcat
cacgctcaaaaggaatacaatggatttaaccttgaggagcagagaaggaagaagagaagg
tggagcaatgaggacatttcctcaggtcctcatgtgacagacactagcctttctcctcca
ctttctccaccttcccctactcctgtcatcaagcccactcatccatcatcttcctcgtcc
tcatcatcatcatcttcctcatcatcttcctccgaatcagactctgagtccagtccaccc
cagaatgttgccaaagtccctgcagattcaacatcaaaccaaaaagctgtgtcaaaaagg
aggcatgacaaacagacttcaggcactggtgctcaaccccacgggtcgagcataagcacc
cctgagatagataaacaaggtcggggcagacacaaactctacacactggtgcctttcggc
cgaactgaaaagtcccccaccgtcgcacatcgaggcctgaaaaaacttgttgtgaggata
gacctctcgcttctgggtagagtccctagtgcagatgagattaccgagggacagtcctca
tcttcagctttgtcatcgggaaaggcaaaagaaaagacatcaatgaaacacctgcaccgc
ttggaccaactgcctggagatggcagaagtaaaagaaaagctgaaaatggagatgctcaa
agagagaataagagaaatcaatcacgtgcagataaactaccagtgtcagtccataatgag
actgaggaaaccttcaacaagcaaaatggatgtcaggacgattacttttattccaagagg
ccagtatccccattatctcctccatctggcatactggagctctcaaaaccctcagtaaaa
gctcagcatgcagagaagtaccacacacctccagaaaaagacaaagattcaacagcacag
aaaaaacaggaccagaagatgcagcccaaggtagaggtggagtgtgtcagggtgtcagga
catctacagtctctctctggatcactggttcctccctcaaaccttccgctccactacaga
ggaactgtacctatcagtgatgtctcacatcatgctgagtactacatgcatgaggccaag
aggttgaaacatcgagcagatgcaatggtggataagttaggaaaagctgtgaattatgtg
gatgctgctttgtccttcatggagtgtggtaaagccatggaagagggaccgctggagtcc
aagtccccctacaccatgtatgctgaaactgtggagctcataagatatgctatgagactt
aagagtaacgccggacctggagccagccaggaagataaacagctagctgtactatgtttc
cgctgtcttgctcttctttattggcaaatgttcagacttaaaaaggacaacgctctaaaa
tactccaaagtcctgctggactacttcaaaagttctccaaaaggtcctcacaacccccct
ccttggaacgatgctggaaagggaactgtacctcctgcctctatttgctcaggcagctca
cagagcagtgttatcagcattccccatcgtatccaccagatggcagccaatcacctcaac
atcaccaacagggtcctgtactgttatgaatactgggaggtggctgatacactggccaaa
gaaaataaggaatttttcaactatctgaacacactgactggacccttgactctgcatagc
agcatggcccatatcgtccagtacaccaggcaagggctgcagtggatccggatcagtgct
aatctatcataa

DBGET integrated database retrieval system