KEGG   Sinocyclocheilus rhinocerous: 107712964Help
Entry
107712964         CDS       T04916                                 

Gene name
abhd6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:srx01002]
    107712964 (abhd6)
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107712964 (abhd6)
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S33
   107712964 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 DUF1057 Thioesterase Ndr Lipase DUF2048 Abhydrolase_5 Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 107712964
NCBI-ProteinID: XP_016373848
Position
Unknown
AA seq 335 aa AA seqDB search
MDLDVVNMFIIAGGTLAIPILAFVASFLLWPAALIKVYHWYWRRRLGMQVDYAEYEGYRF
CYSHRGTPGTRPSVLLLHGFSAHKDMWLGVVKFLPKNMHLVCVDMPGHEGTTRSSAVDYS
IEGQVKRIHQFVKSIGLNRKPFQLIGTSMGGNVAGVYASRHPSDLCGVTLICPAGLQYPT
ESTFVQRLRELEKAQDSDGIPLIPSTPEEMEEMLKLCSYVRFKIPKQILQGLVDVRIPNN
DFYRECFMELVGEKSRHSLHENMHLISTPLQVIWGKNDQVLDVSGASVLAKAIPGSQVHL
LDNCGHSVVMERPRKSAQLIMDFIIAQQNSNKKLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatttggacgtggtgaacatgttcatcattgccggcgggacgctggcgatccccatc
ctggcttttgtagcctccttcctgctctggcctgcagctctcattaaagtgtatcactgg
tattggcgcagaaggctgggaatgcaggtggattatgctgaatatgaaggatatcgcttc
tgttactctcacagagggactccaggcacccgtccgtccgtcctcttgttacacggcttc
tctgcacacaaagacatgtggctcggtgtggtcaagtttcttcctaaaaatatgcacctg
gtgtgtgttgacatgccgggacatgagggtactacccgcagcagtgctgtggattactcc
atcgagggccaagttaaacggatacatcagtttgtgaagagtatcggtttgaacagaaag
cccttccaactgatcggcacgtccatgggaggaaacgtggctggagtttatgcctcccgt
cacccgtctgatctgtgcggcgtcacgctcatctgtccagcaggtctccagtatcccact
gaaagtacgtttgttcagcgtttgagggaactggagaaagctcaggacagtgacgggatc
ccgctgataccctccacaccagaagagatggaggagatgctcaaactgtgttcctatgtg
cgctttaagatccctaaacagattcttcaaggactggttgacgttcgtattcctaataat
gacttctaccgcgagtgtttcatggagcttgtcggagagaaatccagacactctttacat
gagaacatgcatctcatttcaactcctctacaagttatttgggggaaaaacgaccaggtg
ttagacgtgtctggggcttcagttctggccaaagccatcccaggatctcaggttcatctg
ctagacaactgtggtcattcagtagtgatggagcggccgaggaaatccgcccagctcatc
atggactttatcatcgcacaacagaacagcaacaagaaactgtcctaa

DBGET integrated database retrieval system