KEGG   Sinocyclocheilus rhinocerous: 107714557
Entry
107714557         CDS       T04916                                 

Definition
(RefSeq) acid-sensing ion channel 1-like
  KO
K04829  acid-sensing ion channel 1
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:srx04040]
    107714557
Ion channels [BR:srx04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   107714557
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 107714557
NCBI-ProteinID: XP_016375912
Position
Unknown
AA seq 494 aa
MKTSVMDLKVEAMDIDYDQPPPLQVFAHTSTLHGISHIFSYEKITAKCCLWVVFFLSSLT
FLMYVCVDRIQFYLEYPHVTKLDEITTPVMVFPAVTICNLNSIRFSRITRNDLYHAGELL
ALLDSRHEIRDAHLVEESVMEVLKSKADFRSFKPRPFNMWEFYNRTGHDIKDMLLSCQFR
GSPCRPEDFSVVFTRYGKCYTFNSGNTGAPLVSVKGGMGNGLEIMLDIQQDEYLPVWGET
DDSSFEAGIKVQIHSQDEPALIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKATPPS
SDYFKAYSISACRTDCETRYLVENCNCRMVHMPGDAQYCTPVLYKECAHPALDFLVERDS
DYCSCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEKYITISVIVSIVFFQNVNVQ
SVCVCVLVGDIGGQMGLFIGASVLTILELFDYLYEVMKYRLCRCSDKKHHNNNNTDHGTV
LGLDDVKCHVSKFH
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaagacatcagtgatggatcttaaagtggaagctatggacattgattacgaccagccg
cctcccctccaagtgttcgctcacacctcgactctacacggcatctctcatatcttctcc
tatgagaagatcacggccaaatgctgcctctgggtggtgtttttcctcagctccttgacc
tttctcatgtacgtctgcgtcgatcggattcagttctacctggagtaccctcacgtcacc
aagctggacgagatcacgacgcccgtgatggttttcccagcggtgacgatttgcaatctc
aactccatccgcttcagcaggatcacacgcaacgacctgtaccacgcgggcgagctgctg
gcactgctggactccagacatgagatacgggacgctcacctggttgaagaaagcgtgatg
gaggttctcaagagcaaagcagactttcgctccttcaagccgcgacccttcaacatgtgg
gagttctataatagaacaggacacgacataaaagacatgctgctctcctgccagttcaga
ggttcgccgtgtcgacccgaagacttcagcgtggtgttcacgcgttacgggaagtgttac
acctttaactcgggtaacaccggcgcgccgctggtcagcgtgaagggagggatgggaaac
ggcctggagatcatgttggacattcagcaggacgaatatttacctgtgtggggagagaca
gacgactcgtcgtttgaggcgggaatcaaagttcagattcacagtcaggacgagcctgcg
ttaatagatcagctgggcttcggagtcgcaccaggattccagacgttcgtttcttgccaa
gagcagcgactggtgtatcttcctgctccgtggggcagctgcaaggcaaccccgccgagc
tcagactacttcaaagcgtacagcatcagcgcctgtcgaacggactgcgagacacgctac
ctggtggaaaactgcaactgccgcatggtgcatatgcctggtgatgcgcagtactgcact
cctgtgctatataaagaatgtgcacatccagcactagatttcctggtggagagggacagt
gactactgctcatgcgagactccgtgcaacatcacgcgctacagtaaagagctatccttc
gtcaagatccccagcaaagcgtcagtcaaataccttgcaaagaagtacagcaaatctgag
aaatacataacaatttctgtgatagtttctattgttttttttcaaaatgtaaatgttcag
tctgtgtgtgtttgtgtgttggtaggtgatatcggaggacagatggggctgttcattgga
gccagtgttcttacgattttggagctttttgactacctttatgaggtaatgaaatacagg
ttgtgccgctgctctgacaagaagcatcacaacaacaacaacactgatcacggcactgta
ctcggcctggatgatgttaaatgtcacgtcagtaaattccattaa

DBGET integrated database retrieval system