KEGG   Sinocyclocheilus rhinocerous: 107715357Help
Entry
107715357         CDS       T04916                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107715357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:srx04040]
    107715357
Ion channels [BR:srx04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107715357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF4834 DUF2061
Motif
Other DBs
NCBI-GeneID: 107715357
NCBI-ProteinID: XP_016376951
Position
Unknown
AA seq 938 aa AA seqDB search
MFGIWLFVSFSNANGNMWQSFVLLFTGLLGLCSCSNFPSNINIGGLFPTDSHEYDVFRFA
LSQHNDVPKLVPQVDMVDTGSSFAMTYAFCSQFSKGVYAIIGLYDRKTMNMLMSFCGALH
VCFVTPSFPIDTNNQFVIQLRPELQDALIGLVEHYKWTKFVYMYSSDSGLTVLQNILDTA
AEKTWQVTSINFDTLTEVAFLKTIQDLDKKKEYRVILDCELERLNSILNLIAAQKKNLKN
YHYIVANLGFLDLNLTEFRKGGANVTGFQLMNYTNPTVSRTIQHWLEFDSKDLKSPKRRL
KYTGALTYDGVTVMATAFQNLRKQHIDISRRGNAGECLANPPAPWGQGIDIQRALQQVQF
EGLTGHIQFNEKGHRTNFTVSVMEFGPNGPKKVGYWSQHEKYVNTATYSNMLNETFGLQN
RTYIVTTILESPYVMLKKNHEQLVGNDKYEGYCVELAAEIAKHVGYSYRLEIVGDRKYGA
RDSETMMWNGMVGELVYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKP
GVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHADDEEEGMEQQNQNQNRPPS
PEPNQSPNQHSQNQNQREEKQEKQPEHTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRI
VGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFR
RSKIAVFEKMWSYMKSAEPSVFLKTTDEGVVRVRKSKGKYAYLLESTMNEYIEQRKPCDT
MKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDS
KDKTSALSLSNVAGVFYILIGGLGLAMLVALVEFCYKSRIESQRMKQIIDAAMLSSTLTR
MGSGGENGRVMAHDFPKAAQTLPCMGQAAAMGLSTTGM
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcatttggctctttgtcagtttctcaaatgcaaacggaaatatgtggcaaagc
ttcgtcttactctttaccggtttgcttgggttgtgttcatgttcaaatttcccaagtaac
atcaacataggaggtttgtttccaaccgactcccatgaatacgacgtgttccgtttcgcg
ctctctcaacacaatgatgttcctaaactggtaccacaagtggacatggtggacacgggg
agcagctttgccatgacatacgccttttgttcccagttctccaaaggagtctacgccatc
atcggcctgtatgacaggaagaccatgaacatgctgatgtcattctgtggcgctctacat
gtgtgcttcgtcacgcccagcttccccatcgataccaacaaccagtttgtgatccagctg
agacctgagctccaggatgctctgatcggccttgtcgagcactacaagtggaccaagttc
gtctacatgtacagctcggactcaggtctgacggtgctgcaaaacatcttggacactgct
gctgagaagacctggcaggtgacatccataaactttgacaccctgacagaggtagcgttc
ttgaaaaccatccaagatctggataagaagaaggaatacagggtcattctggactgtgag
ctggagagactcaactccatcttaaatttgattgcggcacaaaaaaagaacttgaagaac
taccattacatagtagcaaacctgggatttctggatcttaatctcacagagttcaggaag
ggaggtgccaatgtgacaggcttccagctcatgaactacacaaaccctactgtcagcagg
acaatacagcactggctggagtttgacagtaaagacttgaaaagtcccaaaaggagactc
aagtacactggagcactcacatatgacggggtgactgtcatggccactgccttccagaac
ctgagaaagcagcacattgatatctctcgcagggggaatgcaggagagtgtctggctaac
cctcctgcaccctggggccaaggcatcgacattcagagagccctacagcaggtgcaattt
gaagggcttacaggacatattcagtttaatgaaaaaggacatcggaccaacttcaccgtc
agcgtgatggaatttggcccaaacggacccaagaaagtgggctactggagccaacatgag
aaatacgtgaacacagctacttacagcaacatgctcaatgagacgtttggactgcaaaac
aggacctacatagtcaccaccatcttggagtctccatatgtgatgctgaagaagaaccat
gagcagctagtgggtaatgacaaatatgaaggttattgtgtggagctggctgcagagatc
gccaagcacgtgggctattcctacagactagaaatagtgggggacagaaagtatggagcc
agagactcagagacaatgatgtggaatgggatggttggagaactagtgtatggcaaagca
gacgtggctgtcgcccccctcaccatcactttggtcagagaggaggtcatcgatttctcc
aagccctttatgagcttaggtatatccatcatgatcaagaagcccaccaagtccaaacca
ggtgtcttctccttcctggacccattggcatacgagatctggatgtgcattgtgtttgcc
tacattggcgtgagtgtggtgctgttcctggtgagtcgcttcagtccgtatgagtggcat
gcagatgacgaagaggaaggaatggagcagcaaaaccaaaaccagaaccgaccaccatca
ccagaacccaaccagtcgccaaatcagcacagtcaaaatcagaatcaacgagaggagaag
caggagaagcaacctgaacacaccaatgaatttgggatcttcaatagcctgtggttttcc
ctgggagccttcatgcagcaaggatgtgatatctcaccaagatctctctctggtcgtata
gttggaggtgtgtggtggttctttactctgattatcatctcctcctacacagccaacctg
gctgccttcctcactgtggaaagaatggtgtcacccatcgagagtgctgaggatctggct
aagcaaacagagattgcctatgggactctggatggaggatccaccaaagagttcttcagg
agatcaaagatcgcagtatttgagaagatgtggtcctacatgaagtctgcagagccttct
gtatttctgaagacgacagacgaaggtgtcgtgcgggtgaggaagtccaaagggaagtat
gcttatctgctggagtccacaatgaacgaatacattgagcagcgcaagccatgtgacacc
atgaaggtgggcggaaacctggactcaaagggctatggaatagcaacacctaaaggatcc
gccctgagaaacccagtaaacctggcagtgttaaaactgaacgagcagggcctgttggac
aaattgaaaaacaaatggtggtacgacaagggagagtgtggcagcggaggaggtgattcc
aaggataagaccagcgctctgagcctcagtaatgtggctggagttttctacattctgatt
ggtgggcttgggctggccatgctggtggccctggttgagttctgttacaaatccagaatc
gagtctcaaaggatgaagcaaatcattgatgcggccatgctcagctccacactgactagg
atgggcagcggtggtgagaacggacgcgtgatggcccatgacttccccaaagcggcacag
actctgccctgtatgggccaggcagccgccatgggcctcagcaccactgggatgtaa

DBGET integrated database retrieval system