KEGG   Sinocyclocheilus rhinocerous: 107717522Help
Entry
107717522         CDS       T04916                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00561  Glycerolipid metabolism
srx01100  Metabolic pathways
Module
srx_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107717522
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:srx01002]
    107717522
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107717522
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S33
   107717522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 DLH Esterase Peptidase_S9 Lipase_3 LIDHydrolase PGAP1 Chlorophyllase2 PAF-AH_p_II DUF1350 Abhydrolase_5 Thioesterase DUF1057
Motif
Other DBs
NCBI-GeneID: 107717522
NCBI-ProteinID: XP_016379779
Position
Unknown
AA seq 343 aa AA seqDB search
MNEIPGMHTLATCLLVAAVSYWYSSELLTALRLFISDSALGGEMPEPEGNRRSPQGVPYT
DLPHIVNADGLHLFCRYWEPDSPPKALVFVAHGAGEHCGGYADIAHSLTQHGILVFAHDH
VGHGQSEGERMDIKNFQIYIRDVLQHIDIMKGRYPKLPVFIIGHSMGGAISILTTCERPQ
DFAGVVLIGPMVQMNAESATPFKVFMAKILNRLTPKLSLGSIESKWVSRDPKQVEAYDTD
ELNYHGGLRISFGMQLMEAAARIERELPNITWPFFILHGDADKLCDIRGAHLMYNGAKST
DKKLKVYEEAYHALHHDLPETIESVLKEVSTWILERLPGPHGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaattcccggaatgcatacgctagccacctgcctgttagtcgctgctgtttca
tactggtacagcagcgagcttctgacagcgctccgtctgtttatttcagactcagccctc
ggcggggaaatgccggaacccgaggggaatcgtcggtcaccgcaaggtgttccatacacc
gacctgccgcacatcgtcaacgccgacggactgcacttgttctgccgttactgggagccc
gacagtcctccgaaggctctggtgtttgttgcccatggagcaggagagcactgtggggga
tatgctgacattgctcacagcctgacccagcatggcattctggtgttcgcccacgatcac
gttggtcatggccagagtgaaggtgagagaatggatatcaaaaacttccagatttacatc
agagacgtcctccagcacattgacatcatgaagggccggtaccccaagctgccagtcttc
atcattggacactcaatgggaggggccatttccattctgaccacctgtgagaggccgcag
gattttgcaggtgtggttctcataggccccatggttcaaatgaacgctgaatctgctaca
cccttcaaggttttcatggcaaaaattctaaaccgtttgactcccaaactctctcttggt
tcgatcgagtcaaaatgggtctcacgggatcccaaacaggtggaggcatatgacacagat
gagctaaattatcacggagggctgcgcatctcatttggaatgcagctgatggaagctgcg
gctcgtatcgagagagaattacccaacatcacatggcccttcttcattctccatggcgac
gccgacaagctttgtgacatcagaggtgctcatctaatgtataatggggccaagagcact
gataaaaaactgaaggtatatgaagaagcctaccatgccctacatcatgacttacctgaa
acaattgagtctgtcttaaaggaggtgagcacctggatcctggagagactccccggccct
catgggtcttag

DBGET integrated database retrieval system