KEGG   Sinocyclocheilus rhinocerous: 107719345Help
Entry
107719345         CDS       T04916                                 

Definition
(RefSeq) myotubularin-related protein 4-like
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107719345
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107719345
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107719345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107719345
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107719345
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107719345
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107719345
Protein phosphatases and associated proteins [BR:srx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107719345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE FYVE_2 IBR DUF4709
Motif
Other DBs
NCBI-GeneID: 107719345
NCBI-ProteinID: XP_016382229
Position
Unknown
AA seq 499 aa AA seqDB search
MDNLVSACENGVPLTRTSSDPNLNKHCQESNQPAAIQSAASSEDPPEPGCEETSSSISRE
DDLGVEPCLTTQPLPSLPHPLAVDQAPPLPVTNQAPPQIPISSPQEIRTAENTNPPLCNG
FAHVGNASGSANSEAIAPMEASVETLTEQSAIPPSRKAIDVAFETLIRNGELVPTRERPP
PADYAKAARRLISQSQLTELSLLGSQWDSVQGLVQSACGGAIKHGSYHSRRLANKLLRAQ
AGSANGGPCCRRDPLRAPGSPIQSGWFSAVRNSSYAALCSSAASSLAMGPSFRQLLPSHS
SASSSGSPAPAHLDDDGLPVAVDAVQQRLRQIEASYKQEVEVLRRQVRQLQLKLESKQFC
TPPSEPDVDYEDDITCLRESDGSDEEDSLSSHSEDRLSEGSWDRVERKDTEVTRWVPDHM
ASHCFNCDCEFWIAKRRHHCRNCGNVFCKDCCHLKLPIPDQQLYDPVLVCTPCHDLLLES
RTRELRSQQLKKAIATASS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggacaacttggtgtctgcttgtgagaacggcgtgccgctcacccgcacctcgagtgac
cccaacctgaacaagcactgccaggagtccaaccaacccgcggccatccagagcgccgct
tcatccgaggacccgcctgagccggggtgtgaggaaaccagctcttcaatatctcgtgag
gacgatttaggggtggagccttgtttgacaacccagccccttccatctttgccccacccc
ttagcggtagaccaagccccgccccttccggtcacaaaccaagctccgcctcaaatccca
attagctcaccacaggaaatcaggactgcagaaaacacaaatccacctctttgtaacggc
ttcgcacacgtaggaaacgctagcggatctgcgaactctgaagccattgcaccaatggag
gcgtcagtggagacgctaacggagcaaagcgcaatccctccttctaggaaagccattgac
gtggcgttcgaaacgctgatacgaaacggcgaactggttcccaccagagaacgaccacca
cccgccgactacgccaaagcagcccgccgtttgatttcccaaagccaactgacagagcta
tcgctgctaggttcccaatgggacagcgtccaaggcctggtccagtcggcctgcggcggc
gccatcaaacatggcagctatcacagccgccgcctagcaaacaagctcctccgtgcccaa
gccggaagcgctaatggcgggccgtgttgccgtcgagaccctctgcgcgctcctggaagc
cccatccagtcgggctggttctctgcggtgaggaactccagctacgccgcgctttgttcc
tcggcggcgtcttcgctagcaatgggaccgtccttccggcagctgctcccgtcgcattcc
tcggcctcctccagcggctctccggctccggcgcacctggacgacgacgggctgccggtg
gcggtggacgcggtgcagcagcggctgcggcagatcgaggccagctacaagcaggaggtg
gaggtgttgaggcggcaggttcgacagctgcagctcaaactggagagcaagcagttctgc
acgccgccctctgaacccgacgtcgactacgaggacgatatcacgtgtctgcgggagtca
gacggcagtgacgaggaagactctctgtccagtcacagcgaggatcgcttgagcgagggc
agctgggaccgtgtggagaggaaggacacagaggtcaccagatgggtgccggatcacatg
gcctctcactgcttcaactgcgactgtgagttctggattgccaagagacgccatcactgc
aggaactgtgggaacgtgttttgtaaggactgctgtcacctgaagctgcccatcccagac
cagcagctgtacgacccggttctggtgtgcaccccctgccacgacctgctgctggagtcc
cgcacgcgagagctgcgctcgcaacagctgaagaaagccatcgccaccgcctccagctga

DBGET integrated database retrieval system