KEGG   Sinocyclocheilus rhinocerous: 107719349Help
Entry
107719349         CDS       T04916                                 

Definition
(RefSeq) uncharacterized protein LOC107719349
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00564  Glycerophospholipid metabolism
srx00565  Ether lipid metabolism
srx00590  Arachidonic acid metabolism
srx00591  Linoleic acid metabolism
srx00592  alpha-Linolenic acid metabolism
srx01100  Metabolic pathways
srx04010  MAPK signaling pathway
srx04217  Necroptosis
srx04270  Vascular smooth muscle contraction
srx04370  VEGF signaling pathway
srx04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107719349
   00565 Ether lipid metabolism
    107719349
   00590 Arachidonic acid metabolism
    107719349
   00591 Linoleic acid metabolism
    107719349
   00592 alpha-Linolenic acid metabolism
    107719349
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107719349
   04370 VEGF signaling pathway
    107719349
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107719349
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107719349
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107719349
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107719349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Glyco_hydro_42C
Motif
Other DBs
NCBI-GeneID: 107719349
NCBI-ProteinID: XP_016382234
Position
Unknown
AA seq 749 aa AA seqDB search
MASLYQEPDWSTKLETVKDNIIKRLSGPGVSWDDKSAKLKKYYMKDFFSLTDLWAVLFVT
SYVKEIDEQTLTDQRDLHNEDPYPIYAVIDKQCKRREEGDPWFEISPHEAGYSLSGAFVE
TCNFGSQFDNGSKKKHQPEMDMLYLQAMCSSALADGEATWKWIKAISVPEIKSVLDKMEQ
DQSGGNASRTTQEPVGEDECYQELLNPVDADPSALEQSSRTKLTDLFGGQRQFGQTADKH
KKTARCIAQRIWGRNYNFLHNMTDESVPAALLQKETRDLIDAGLLINSPYFSVLRKERNI
DLIIALDYSDGDPFTTVREAAKTCKKLKIPFPEVNIPSDEGKKPKDFYVFKGQNAPTVIH
IPLFNVVNCGVLECLEEAPMSLSELLLSFGLEKIDEQTLTDQRDLHNEDPYPIYAVIDKQ
CKRREEGDPWFEISPHEAGYSLSGAFVETCNFGSQFDNGSKKKHQPEMDMLYLQAMCSSA
LADGEATWKWIKAISVPEIKSVLDKMEQDQSGGNASRTTQEPVGEDECYQELLNPVDADP
SALEQSSRTKLTDLFGGQRQFGQTADKHKKTARCIAQRIWGRNYNFLHNMTDESVPAALL
QKETRDLIDAGLLINSPYFSVLRKERNIDLIIALDYSDGDPFTTVREAAKTCKKLKIPFP
EVNIPSDEGKKPKDFYVFKGQNAPTVIHIPLFNVVNCGGKPGDWRKKYGILKGPYSAEMI
TEVMGVAGKNISNNIEKLLEQIRAVAEAK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttataccaagaaccagactggtccaccaaactagagaccgtgaaagacaat
atcatcaagagactcagcggaccaggagtcagctgggacgacaaatcggccaaattgaag
aaatattacatgaaagacttcttcagcttgactgacctctgggcagtgctgtttgtcaca
tcatatgtgaaagagatcgatgaacaaacactcacagatcagcgggacctgcacaatgaa
gacccgtatcccatttacgcagtgatcgacaagcaatgcaaaaggcgtgaggaaggagac
ccctggtttgagatcagtccacatgaagcaggttattccctctctggagcgtttgtggaa
acctgcaactttggcagccagtttgacaacggctcaaagaaaaaacaccagcctgaaatg
gacatgctgtacctgcaagctatgtgcagcagtgctttagctgatggagaggcgacctgg
aaatggataaaagctatttcagtacctgaaataaaatcggtattagacaaaatggagcaa
gatcaatccggaggaaacgcctcaagaaccactcaggagcctgtcggtgaagacgaatgt
taccaggagctcttgaaccctgtggatgctgacccttctgcccttgagcagtcctccaga
acaaagctgaccgacctttttggaggccaaaggcagtttggccaaactgctgataagcac
aaaaaaacagccagatgcattgctcagaggatctggggcaggaattataacttcctccac
aacatgacagatgaatcagtgccagccgctcttttgcaaaaagagacgagagatttaata
gacgccggactgttgatcaactcaccctacttctcagtgctgagaaaagaacgaaacatt
gacctcatcattgctctggattacagcgatggagatcctttcacgacagtgagagaagct
gctaaaacgtgcaagaaactaaagatccctttccctgaagtcaacattcccagtgatgaa
gggaagaaaccaaaggacttctatgtgttcaaaggccaaaacgctccaaccgtgattcac
atccctctgtttaatgtggtcaactgtggagtgcttgaatgtcttgaagaggctccgatg
tcgctgtcagagcttctgctctcatttgggctggagaagatcgatgaacaaacactcaca
gatcagcgggacctgcacaatgaagacccgtatcccatttacgcagtgatcgacaagcaa
tgcaaaaggcgtgaggaaggagacccctggtttgagatcagtccacatgaagcaggttat
tccctctctggagcgtttgtggaaacctgcaactttggcagccagtttgacaacggctca
aagaaaaaacaccagcctgaaatggacatgctgtacctgcaagctatgtgcagcagtgct
ttagctgatggagaggcgacctggaaatggataaaagctatttcagtacctgaaataaaa
tcggtattagacaaaatggagcaagatcaatccggaggaaacgcctcaagaaccactcag
gagcctgtcggtgaagacgaatgttaccaggagctcttgaaccctgtggatgctgaccct
tctgcccttgagcagtcctccagaacaaagctgaccgacctttttggaggccaaaggcag
tttggccaaactgctgataagcacaaaaaaacagccagatgcattgctcagaggatctgg
ggcaggaattataacttcctccacaacatgacagatgaatcagtgccagccgctcttttg
caaaaagagacgagagatttaatagacgccggactgttgatcaactcaccctacttctca
gtgctgagaaaagaacgaaacattgacctcatcattgctctggattacagcgatggagat
cctttcacgacagtgagagaagctgctaaaacgtgcaagaaactaaagatccctttccct
gaagtcaacattcccagtgatgaagggaagaaaccaaaggacttctatgtgttcaaaggc
caaaacgctccaaccgtgattcacatccctctgtttaatgtggtcaactgtggaggtaag
cctggtgattggaggaagaaatatggcatcttaaaaggcccttacagcgctgagatgatc
actgaagttatgggggtcgctggaaaaaacatctcaaacaacatagagaaactgctggag
cagattcgtgcagtcgctgaagctaaatga

DBGET integrated database retrieval system