KEGG   Sinocyclocheilus rhinocerous: 107719973Help
Entry
107719973         CDS       T04916                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04260  Cardiac muscle contraction
srx04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107719973
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107719973
   04261 Adrenergic signaling in cardiomyocytes
    107719973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:srx04040]
    107719973
Ion channels [BR:srx04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107719973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 107719973
NCBI-ProteinID: XP_016383016
Position
Unknown
AA seq 309 aa AA seqDB search
MLMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSNNENETSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDAAEYLLRAVRASSIFPIMSVGLLFMGGL
CVAAGEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWSFY
FGALSFIMAEMVGVLAVHMYIEKHRKLRTKSRTELIKKSAFSRIPSYRYRFRRRSSCRSS
EPASRDASPMGKSGYTGPAAADISMYTLSRDPSKAAMGALLNSEREFLQAHNSNTKDFKD
AANRRTTPV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgtgtgacagaggagtccaaatgctcatcaccacagtgggcgcgttcgcagcg
ttcagcctgatgactatcgctgtgggaacggactactggctgtactcacgaggagtgtgc
cgggtcaaaagtaataacgagaacgagacgagcaggaagaatgaggaagtcatgacccat
tccggactgtggagaacctgctgtctagaaggaacatttcgaggtgtctgtaagaagatt
gaccactttccagaggatgcagattatgagcaggatgcagcagagtatttactacgagca
gtgagagcgtccagcatcttccccatcatgagcgttgggcttctgttcatgggaggtttg
tgtgtggctgccggtgagttttacaggagcagacacaatgtcatcctcagtgctggaatc
ttctttgtctctgctggcctaagtaacatcatcggcattatcgtgtacatatctgccaat
tcgggcgaccccggccagagcgactcgaagaagagctactcgtacggctggtctttctac
ttcggcgcactgtccttcataatggccgagatggtgggcgtgctcgccgtgcacatgtac
atcgagaaacaccggaagctgcgcaccaagtcccgcaccgagctgatcaagaagtcagca
ttcagtcgcatccccagctacagatatcgattccgccgccgctccagctgccgctccagt
gagcctgcctctcgtgacgcttcgcccatgggcaagagcgggtacacgggccccgctgcg
gcagacatctctatgtacaccctgtccagggatccctccaaggcggcaatgggtgccttg
ctcaactctgagagggagtttttgcaggctcacaactccaacactaaggacttcaaagat
gcggccaacaggaggaccactccagtctga

DBGET integrated database retrieval system