KEGG   Sinocyclocheilus rhinocerous: 107720483
Entry
107720483         CDS       T04916                                 

Definition
(RefSeq) adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00230  Purine metabolism
srx01100  Metabolic pathways
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04371  Apelin signaling pathway
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107720483
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107720483
   04020 Calcium signaling pathway
    107720483
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107720483
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107720483
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107720483
   04914 Progesterone-mediated oocyte maturation
    107720483
   04916 Melanogenesis
    107720483
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107720483
   04270 Vascular smooth muscle contraction
    107720483
Enzymes [BR:srx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107720483
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 107720483
NCBI-ProteinID: XP_016383687
Position
Unknown
AA seq 951 aa
MLLIIAFVFIFTGGVVTAWEQVAFFLFLSLSVYTVLPLPLSWALSFGIGTSVSHIVVISV
YVSVTSPQTQDLAVQLVANAVLFVCVNAVGVFHLWHTEHAHRKSSKKREDFSRNRATQAK
QKRDQEHLLLSVLPRYIAMELKTEIVKRLSAKCSAEENRPNFHSLYIRQHKDISILYADI
VGFTHLSSTCTPEELVAVLNKLFGRFDDIAKKNGCLRIKILGDCYYCVSGLPDPISHHAR
NCVQMGLDMCTAINKLREATDVNINMRVGVHTGNVLSGVIGLQKWQYDVWSDDVTLANHM
ESGGVPGRVHITEDTLAHLDGKYQVEEGNGGSRNSTLKEKRTFLVIDPNAENSNTTPETH
ELKVDNNPVNRQKLRASVRMSQYLQSWKTVKPFSGLNQPEASLAAPPTSDSISQPQPATV
LTEFNTPRSSQVLENGLIDSLDSLRNEGKRAKLNSVTLFFNHFQLEKQYSLSEVQGLHRS
VICLAFIFISVFVVQMLTSQRNFALAVSYGATFPVQILIVLVVFTKFLKRWHSKFPRSIR
WVSTLFDGVATRAALRLLLVFLCLLITLLMAVLNIVFIPGDNCLNVSHNATVLNTLNLYT
VPYYLYCCLLAMLGVIVFVRVSVSVKVFLLTLAVVVYLALFLHVYAPRSDCYMKQLYSGN
STPGVLKEPKIMSGIWLVIFYLISLILVRQDELGSRTEFLLEKCFNKETEEMETTKNVNR
LLLQNLLPEHVTDFFIGKDIQNQDLYSKSCECVCVMFASVPHFFKEFYNESSVNNDGLEC
LRFLNEIISDFDELLNKPKFSAVEKIKTISSTYMAVAGLTKPAKTEERRTCDMSYSHIRS
MLDFAIALMGRLENINMHSFNSFQLRIGINHGPLIAGVIGAHKPQYDIWGNTVNVASRMD
STGVLDKIQVTEETAQVAQRLGFGVTLRGAIHVKGKGQLSTYFINTEHSVQ
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgctcctcatcatcgccttcgtcttcatcttcaccggaggcgtcgtcacggcctgggag
caggtcgcgttcttcctcttcctgtcgctgtctgtttatacagttcttcctctcccgctc
tcatgggctctgagcttcggcatcggaaccagtgtttctcacattgttgtcatcagtgtg
tatgtgtctgtaaccagccctcagacacaagacctggccgtgcagctggtggcgaacgca
gtgctgttcgtgtgtgttaatgccgtgggtgtgtttcacctgtggcacactgaacacgct
cacaggaagtccagcaagaaacgggaagatttcagcagaaaccgcgccacacaagccaaa
cagaaacgtgaccaggagcatctcctgctgtctgtgctgccgcgatacatcgccatggag
ctgaagacggaaatcgtcaaacgtctgtctgcgaaatgcagcgccgaagagaaccgacca
aacttccacagtctctacatccgacagcacaaagacatcagtatcctgtacgctgatatc
gtgggcttcacacacctgtccagcacctgcacacctgaggagctcgttgccgtcctcaac
aaactcttcggcaggtttgacgacatcgccaagaagaacggctgtttgcgcattaaaatc
ctgggcgactgttattactgcgtgtcgggtcttcctgatccgatctctcatcacgctcgc
aactgcgttcagatgggtctggacatgtgcacggccataaataagctgagggaggcgacg
gacgtgaacatcaacatgcgtgttggcgtgcacacgggtaatgtcctgtccggcgtgatc
ggccttcagaagtggcagtacgacgtctggtcagatgacgtgactctagccaatcacatg
gagtctggaggagtgcctgggagagtccacattacagaggacacgctcgctcacctggac
gggaaatatcaggtggaggaaggaaatggcgggagtcgcaattccacactgaaggaaaag
agaacgttcctggtcatcgatcctaatgcagaaaactccaacacgacacctgagactcat
gagctgaaggtggacaacaatcctgtgaaccgtcagaagctccgcgcgtcggttcggatg
tcgcagtacctgcagtcctggaaaaccgtcaaaccgttttctggactcaaccaaccagag
gcttcgctcgcagccccgcccacttctgacagcatcagccaaccacagccggccacagtg
ctcacagagttcaacactccaagatcttcacaagttctggaaaacggactgatagactca
ttagactctctgagaaatgaagggaaacgagcgaagctgaacagtgtgacgttatttttt
aatcattttcagctggagaaacagtattcgttaagtgaagtccaggggcttcatcgctct
gtcatatgtttggccttcatcttcatctctgtgtttgtggttcagatgctgacctcgcaa
agaaattttgcgttggcggtgtcgtacggtgccactttccctgtccaaatactgattgtg
cttgtggtcttcactaagttcctgaagcgctggcactctaagtttccccgcagcatccgc
tgggtctcgacgctgtttgacggtgtggccaccagggcggcgctgcggctgctgctggtg
tttctctgtctgctcatcacgctgctcatggcagtgctgaacatagtttttatcccaggc
gataactgtttaaatgtttcccacaatgcaacagtactgaacactctcaatctctacact
gtcccgtattatctgtactgctgtctgctggcgatgttgggcgtgattgtgtttgtgcgt
gtgagcgtgtctgttaaagtcttcctcctgaccctcgctgtggtggtttatctcgcactc
ttcctgcacgtttacgcaccgcgctccgactgctacatgaaacaactctacagcggcaac
agcacgccaggagttcttaaggagcccaagatcatgtctggcatttggctggtcattttc
tacttgatttcccttattcttgtgcgacaggacgagttgggctctcggacggagttcctg
ctggagaagtgctttaataaagagacggaggaaatggagacgaccaagaacgtcaacaga
ctgctgctgcagaaccttctgccggagcacgtcacagacttcttcatcggcaaagacatc
cagaaccaggacttgtacagtaagtcgtgcgagtgtgtttgcgtgatgttcgcgtccgtg
ccgcatttcttcaaggagttttacaacgagagcagcgtcaacaacgacggcctggagtgc
cttcgcttcctcaacgagatcatttcagactttgacgagctcctcaacaagcccaagttc
agcgccgtggaaaagatcaagaccatcagcagcacctacatggcggtggctggactgacc
aaacctgccaaaacagaggagagacggacgtgcgacatgagctacagtcacatccgcagc
atgctggacttcgccatcgctctgatggggagactggagaacatcaacatgcactcgttc
aacagcttccaactgaggatcgggataaatcacggtcctctgatcgcaggcgtcatcggc
gctcataaacctcagtatgacatctggggaaacacggttaatgtggccagccggatggac
agcactggagtcctggataaaatacaggtgacagaggagacggcgcaggtggctcaaagg
ctaggcttcggcgtaactctgagaggagcgatccacgtgaagggcaaaggacagctgagc
acgtacttcatcaacaccgagcactcagtgcagtga

DBGET integrated database retrieval system