KEGG   Sinocyclocheilus rhinocerous: 107720613
Entry
107720613         CDS       T04916                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00100  Steroid biosynthesis
srx01100  Metabolic pathways
Module
srx_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107720613
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107720613
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 107720613
NCBI-ProteinID: XP_016383825
UniProt: A0A673JKJ6
Position
Unknown
AA seq 421 aa
MKPNKHKATHSAEREFGGALGATCIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPAAHL
WDPLAAVLIVGWITLQSFLYLLPMGKVSEGLVLRDGSRLKYAINGFNALSITAVLLLICL
WLGMPLGYLFDLILPLAVCAIGVSYLLSMYLYIRSFWAPQHALSLGGNTGNPLYDFFMGR
ELNPRIGDFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMLLVNGFQLLYVTDA
LWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYGLQAMFLVVHPQSLSTLGAAGIILLN
GIGYYIFRKSNSQKNQFRRDPTHKSVSQLETIATATGTRLLVSGWWGFVRHPNYLGDLLM
ALAWSLPCGMLHILPYFYVIYFTILLIHREARDEKQCRAKYGLAWDTYCRRVPYRIIPYI
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagcctaacaagcacaaagcaacacattcagctgaaagggaatttggaggtgctctt
ggtgccacctgcatccctgtgttcctgcctctgacggttctgtacctgctgagtgtgtgt
cggtctccagcagccagtgtcctgcagtggcctcctcctttaccccccgcagcacactta
tgggaccctttggccgcagttctgattgtaggttggatcaccctgcagagttttctctat
ctactgcccatggggaaggtttctgaaggattagtcctcagagatggatccagactgaaa
tatgccattaatggttttaatgccctgagcattactgctgtcctgttgctaatatgtctt
tggctgggaatgccactcgggtatctgtttgatctgattttgcctctggctgtgtgtgcc
atcggtgtgtcctacctgctgtctatgtacctgtatatccgctctttctgggcacctcag
catgctttatcacttggaggaaacacgggaaatcctctgtatgacttcttcatgggccga
gagctcaaccctcggattggagatttcgacttgaaatatttctgtgaactaagacctgga
ttaataggctgggtggtaataaacctggggatgttaatgaaagaagtagagctgagaggc
tctccatctcttgccatgctgcttgtcaacggcttccagctcctctatgtgacagatgct
ctgtggaatgaagaggctgtgcttactactatggacattgtgcatgatggatttgggttc
atgttggcgtttggtgacctggcctgggttcccttcacgtatggtcttcaggccatgttt
ctggttgtgcacccacagtcacttagtactcttggagcagcggggattattcttctaaat
ggaattggttattacattttccggaaatctaactctcagaaaaatcagttcagaagagac
cccacacataaaagtgtatcacagctggaaactatcgccactgcaacaggaacgcgtctc
ttggtttcagggtggtgggggtttgtcaggcatccaaactacctgggggaccttctcatg
gctctggcgtggtccctgccttgtggaatgttgcatattctgccttacttctatgtaata
tatttcaccattctgctcatccaccgagaggccagagatgagaaacaatgccgagccaaa
tacggactggcctgggacacgtactgcagacgagtgccctacagaataatcccgtacatt
tattaa

DBGET integrated database retrieval system