KEGG   Sinocyclocheilus rhinocerous: 107721644Help
Entry
107721644         CDS       T04916                                 

Gene name
pisd
Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme, mitochondrial isoform X1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00564  Glycerophospholipid metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107721644 (pisd)
Enzymes [BR:srx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     107721644 (pisd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 107721644
NCBI-ProteinID: XP_016385242
Position
Unknown
AA seq 420 aa AA seqDB search
MVRCCRSLHSSPSCYNLHRVRVDVRRFRPPGSSAGATGEPAHGANNAGTGGPSQLSHRSR
FRLQFPQLALRRRLGQLSCMSRPTVRLRSWPLSFLYYILPFGALKLLAKVGWRPTSRVTI
YKSIPTRLLSRAWGRLNQVDLPTWLRKPIFRLYIWTFGVNMKEAAIEDLQHYRNLGEFFR
RKLKPQVRPVCNSHCVISPADGKILHFGRVKNCEVEQVKGVTYSLETFLGPRNWTENLTA
NRNEDDPGTYQDALVTKEGNELFHCVVYLAPGDYHCFHSPTDWRVAHRRHFPGALMSVNP
GVARWIKELFCHNERVVLSGEWTHGFFSLTAVGATNVGSIRIYFDKELRTNNPRYNKGTY
NDFSYVTNNSQEGVSMRKGEHLGEFNLGSTIVLLFEAPRDFTFNLKAGQKIHFGEPLGTM
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgagatgctgcaggtctttgcatagctctccctcttgctacaatctccacagagtc
agggttgatgtgcggcgtttccgtccgccgggctcctcagcgggagcgacaggggagccc
gcacacggtgccaacaacgccggcacggggggcccatctcagctcagccaccggagccga
ttcaggttgcagttcccacagttggccctacggcggcgactaggccagctgagctgcatg
tcccggcctactgtccgccttcgctcatggcctctgtccttcctctactacatcctgccc
tttggagcgctcaaacttcttgccaaagtaggctggaggcccacaagcagagttacaatc
tacaagtccatacccacgagactcctctccagagcctggggtcgcttgaaccaggtggac
ctgccaacttggttacggaaacctatcttcagattgtatatatggacgtttggagtcaat
atgaaggaagcagctatagaggatctacagcactacagaaacctgggcgagttttttagg
cgcaaactcaaaccacaggttcggccggtgtgcaactcgcactgcgtgatcagtccagct
gatggcaagatccttcattttggccgtgtgaagaactgtgaggtcgagcaggtgaaggga
gtgacctactctctggaaacattcctcgggccgcgcaactggaccgagaatttaactgct
aacagaaatgaggatgatcctggcacttaccaggatgccctggtcactaaagaggggaat
gagttgtttcactgtgtagtttatctggctccaggtgactaccactgcttccactcgcct
acagactggagggtggcacacagacgccacttcccaggtgctctaatgtcagtgaaccca
ggagttgcgcgctggatcaaggaacttttctgccataatgagcgggtggtcttgagtggg
gagtggacacacggcttcttttcactcactgctgtaggagcgacaaatgtaggatctata
cgcatctattttgacaaggagctccgcaccaacaacccacgatacaacaaaggaacctac
aacgacttcagctacgtaactaacaacagccaggaaggtgtgagcatgagaaaaggagag
cacctgggcgagttcaacttgggctcgactattgtactgttattcgaagctccaagggat
tttacctttaatttgaaagcaggccagaagatccattttggagaacctcttgggacaatg
taa

DBGET integrated database retrieval system