KEGG   Sinocyclocheilus rhinocerous: 107722162Help
Entry
107722162         CDS       T04916                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:srx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107722162
   04115 p53 signaling pathway
    107722162
   04218 Cellular senescence
    107722162
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107722162
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107722162
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107722162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase RIO1 FTA2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 107722162
NCBI-ProteinID: XP_016385900
Position
Unknown
AA seq 324 aa AA seqDB search
MDKESSTQQYEPVAEIGEGAYGKVYKARDLKNGGRFVALKRVRVQTEEEGMPLSTIREVA
VLRQLESFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSPEDW
PQEVGLPQSAFSPRPPQPIEDLVPDMDELGKSLLVRFLSFNPSRRISAYDALSHPYFQSL
DSTSKSLYAQPFPSKKPSLEERAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagagagctcgacccaacaatatgagccggtggctgagatcggcgaaggtgca
tatggaaaggtgtacaaagcacgggatttgaagaacgggggccgctttgtagccctaaaa
agagttcgggtgcagaccgaggaagagggaatgccgctgtcaaccatccgcgaggtggcg
gtgctgaggcagctggagtcctttgagcatcccaatgtggtcaggttgtttgacgtatgc
acagtttccaggactgaccgggaaaccaaactaactttggtctttgagcatgtggaccaa
gatttaaccacatatttggagaaagcacctgatccaggagtgccacctgaaactataaag
gatatgatgtaccagctgctgcagggtctggatttcctccactctcaccgtgtggttcat
cgagatcttaagcctcaaaacattctagtcaccagtggaggacagatcaaactggctgat
tttggtctggcacggatctacagctttcagatggctcttacttccgtggtggtgacgtta
tggtatcgtgctcctgaggtgctgcttcagtccagctatgctactcctgtggatctgtgg
agtgtcggctgcatctttgccgagatgttcagacggcgacctcttttccgtgggaactct
gatgttgaccagttaggcaagatttttgatgtggtgggggtcccttctccagaggattgg
ccacaggaggtgggcttgccacagagtgccttttcccctcgccctccccagcccatagag
gacctggtgcctgacatggatgagctgggcaaatcacttttagttcgtttcctgtcattt
aacccctccagaaggatatcagcttacgatgcactgtctcacccatacttccagagtctc
gacagcaccagcaagagtctgtacgcccaacccttccccagcaaaaagccctccctggag
gagagagctgcttga

DBGET integrated database retrieval system