KEGG   Sinocyclocheilus rhinocerous: 107723978Help
Entry
107723978         CDS       T04916                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 2-like
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00140  Steroid hormone biosynthesis
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107723978
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     107723978
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     107723978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 107723978
NCBI-ProteinID: XP_016388201
Position
Unknown
AA seq 380 aa AA seqDB search
MEGIVEGCLGFLYDLLVVICVGLLLLRVAEGRSVRWLVLLMVSGVMLSCLVHSSALKVGL
VSVLCSLIHYVGREEVMLPTKNKAVLITGCDSGFGHDLAKFLDSAGMRVFAGVLDELHPG
ALKLKKDASPNLTVLQLDITNSSQITQAHQYIQSQTGKTGLWALVNNAGVLGYVCDGEIL
PIKMYKKCLDVNFIGSVEITQAFLPLIRQSKGRLISISSMAGEVPLPGFAGYGASKAALI
SFNGAIRQELSRWGVKVIIIQPGAFKTNILGSREQWNSAQEDILSGLAQEVMASYGEEYI
RSMQQRLVNMSSVSSSDTGPFLEALKHAILSPRPKPFYYPGASAWALPLLYRHSPTSLSD
RIFSRIFMSSDAQPAELLNS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaggggattgtagaaggctgtctgggttttctatacgatctgcttgtggtaatttgt
gttgggctgctgcttcttcgggttgctgagggccggtcggtgaggtggttggtgctactc
atggtttctggagtgatgttgagctgcttggtccattcaagcgcccttaaagtggggctt
gtgagtgtgctgtgtagtctcatccactatgtagggagagaagaggtcatgttgcctacc
aaaaacaaggcagtactgatcacaggttgtgattcaggttttggtcacgatctggccaag
tttttggacagcgcggggatgagggtgtttgcaggggttctggatgaactccatcctgga
gctctgaagctgaagaaagatgcatctccaaacctcactgtcctacagttagacatcacc
aacagcagccagatcacacaggcacatcagtacatccagagtcaaacaggcaaaacagga
ctctgggcactagtgaacaatgccggagtgctgggatacgtgtgcgatggagaaattctg
ccaattaaaatgtataaaaaatgcttagatgtaaattttattggtagtgtggagataaca
caagcctttctgcctctaatacgacaatcaaaaggacgactcatcagtatatccagtatg
gcaggagaagttccacttcctggatttgcaggatatggggcatctaaagcagcgctgatc
tcgttcaatggagcaattagacaggaactctcacgctggggagtcaaagtcatcatcatt
caacctggagctttcaaaacaaatattttgggcagcagagagcagtggaatagcgctcag
gaggacatcctcagcggtctggctcaggaagtgatggcgtcttatggagaagaatacatc
cgctcaatgcagcagcggctggtcaacatgtcttcagtatcaagctcagacacggggccg
tttctggaggctttaaagcatgccatactgtccccgagaccaaagcccttctattacccc
ggggcctcggcgtgggctcttccattactctacagacacagccccacctcactgtctgac
agaatcttctcacgaatctttatgagcagtgatgcccaaccagcagaactcttgaattct
tga

DBGET integrated database retrieval system