KEGG   Sinocyclocheilus rhinocerous: 107724480Help
Entry
107724480         CDS       T04916                                 

Definition
(RefSeq) arginase, non-hepatic 1-like
  KO
K01476  arginase [EC:3.5.3.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00220  Arginine biosynthesis
srx00330  Arginine and proline metabolism
srx01100  Metabolic pathways
srx01230  Biosynthesis of amino acids
Module
srx_M00029  Urea cycle
srx_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107724480
   00330 Arginine and proline metabolism
    107724480
Enzymes [BR:srx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     107724480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 107724480
NCBI-ProteinID: XP_016388933
Position
Unknown
AA seq 327 aa AA seqDB search
MALRGPLSRLLRFTLSSCQQNRSHSVAVLGAPFSKGQKRRGVEHGPKAIRDAGLVERLSN
LDYAVHDFGDLTFKHLEKDEHFMHVPFPRTVGRANQLLSGAVSGAVGAGHTCIMLGGDHS
LAIGSVEGHAQQCPDLCLIWVDAHADINTPLTSPSGNLHGQSVAFLLKDLQNKMPEVPGF
SWMKPFLSARDLVYIGLRDVDPGEHIILKTLGIQYFSMRDIDRMGIQRVMEVTLDHLLAR
KQRPIHLSFDIDAFDPSLAPATGTPVNGGLTYREGIYVTEEIHNTGLLSVMDVVEVNPTL
GATPEAVDSDFSKQNGLDHNDPENLDY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggccttgagaggaccactgtctagattattgagattcacgttgagttcctgccaacag
aaccgatcgcattctgttgctgttttgggagctccgttttccaaaggacagaaaaggaga
ggggtggagcatggacccaaagccatccgggatgcgggtttggtggagagactttcaaat
ctggactacgctgtgcatgattttggagacctgaccttcaagcatctggaaaaagatgag
cactttatgcatgtgccgttcccacgcacagttggacgtgccaatcagctgctgtcggga
gctgtgagtggtgcggtgggggcgggacacacctgcatcatgttggggggagaccatagc
ttagcgattggttcagtggaaggtcacgctcagcagtgccctgacctgtgtctgatatgg
gtggacgctcacgcagatatcaacactcctctgacttcaccttctggaaacctccacggc
caatctgtagcattcttacttaaggacctgcagaacaagatgccagaagttcctggattt
tcttggatgaagcctttcctgtctgccagagatctggtctacattggcctcagagatgtg
gatccaggcgagcatataatcctgaagaccctgggaatccaatatttctccatgcgtgat
attgacagaatgggcattcagagggtaatggaggtcactttggatcacctcttggcaagg
aaacaaaggccgatccatctgagctttgacatcgatgcatttgacccgtccctggctcct
gccactggaactcccgttaatggaggattgacctatagagagggcatctacgtaacagag
gagatccataacacaggtttactctctgtgatggatgtggttgaagtgaaccccacacta
ggtgcgacacctgaggctgtggattctgatttttcaaagcaaaatggactggatcacaat
gatccagaaaatctggattactag

DBGET integrated database retrieval system