KEGG   Sinocyclocheilus rhinocerous: 107725310
Entry
107725310         CDS       T04916                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:srx01002]
    107725310
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107725310
Peptidases and inhibitors [BR:srx01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107725310
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_CCN TSP1_spondin Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 107725310
NCBI-ProteinID: XP_016390054
Position
Unknown
AA seq 1406 aa
MWSNMGTLIWFFLVPSLIKTTALLISQCTLQKDFLESLKPQDLFYYFDTISVKSVPHFEL
VWVNCSGNESFRGLWRCSFQSDGESFELGQHRDEQPMSCPTSLETVINSTVSVVKKREDM
CCEQLKLLRPAHTRTLLPICHGKLQGLIQSGEKRLNIRPVLQKHIDHLKELTMDLPSGVP
HLLLTHTLPVRKRLKQPKSQFRLRRTPLGSEVTHLELAVVVGPDVYDAHRQDTERYILTN
LNIASELLRDVTLGASIRVNLVRMVILTEPKPDIQISENITSSLKSVCKWGQKVNPDADT
DPLHADLLLYITRFDLVLPNGNKLVRGVTQLGGVCSSQWNCVITEDTGFDLGITIAHEIG
HSFGINHDGIDNTCSSSGFMMASDGGYNSVDLTWSQCSRAQLHNFFSAGKAECVKDVPVL
GASVQDWRPGLFYGVDDQCRIAFGSSATACSFTNGDMATCRVLSCHINPRDRSSCTRLLV
PLLDGTECGPSQWCLKGRCVSPSTLGSSMMVHGSWSSWSELSVCSRTCGGGITYRRRQCN
NPRPAFGGTVCKGQDTEAELCNRQLFGCDGVMHSGKVEDVCGVCGGNGSTCQFISNTYSG
GEAGEYVTFLSLPLNASQVHVINTKPVFTHLAVLSNDKYVVSGDGSPGLSITYPSPLEKS
PIIYNLFLTPDHLPQTEELTISGPITDKIHIQVFRKYGQEYGDLTTPNISYQYYSSEAVS
VERAAEGRWSTVISACSVTCGTSIQKISQLCVDGLTLKRLEDELCSSHPRTPYQLQPCFQ
PDCPPRWQVSEPGECSAVCGPGEAQRTVSCVRSHHGSDSEVNQNLCPEPKPPEHVPCVVD
VCPVGWDSQRETQLIRTDTHIMPRSRMVPVYVWSPVIGQCSKTCGAGSQQVWFSCVDHQS
RLEVPEFLCDHTNKPEMYAQPCSLSICPATWRYMQGPCSVSCGGGVAKRVLYCSQMVQGG
DGNTDLVVGESACQSVARPSEVVECNTEACPTRWQAGEQGDCSVSCGMGVAVRSVRCVQY
EGGIERVVEEGRCDPGNKPPVTAPCFTQVCSFNWDVHEWSECSVSCGDGIQSRTVSCMGP
SSPLPVSPFLCLHLPKPITIQACYSPDCSLAQTSTPEPNSTHMQSEARRGEGTWRTTPAP
APAPAPAVRMMTMRKSFSAIVPTADVMRSTMSTTTEPPQTSFCGQLLLQDSGTIDLRNVT
QARCIFAIGRPLDEVIQIKIISSTLNCRQKENIALYDRLILMRLCERMTSKMLKSRSNVL
LVRQSRLTPGNGVLLFYQSIKNKKSHHGECDVQLFSPSGLIENPIKSAATSTSNTQSCRV
FIDAPPAFRIQIRALSVLNNTDTNSTYILIRDVDALKTTIFRGTRLFLWSSSGSRAEVEF
HGEYQQIKGMFRAEYSYINPSEEQPV
NT seq 4221 nt   +upstreamnt  +downstreamnt
atgtggtcaaacatgggaactctgatctggttctttctggttccaagcctgataaaaaca
acagctctactgatttcacaatgcactttgcagaaggattttttagagtctctgaaacct
caagatttattttattattttgatactatttccgttaaatcagtgcctcactttgagctg
gtgtgggtgaattgctcagggaatgagtctttcagagggctatggaggtgctcgtttcag
agtgatggagagagctttgagctgggccaacacagagatgaacaacccatgtcttgtccc
acgagtctggagacggtgatcaactcaacggtcagcgtggtgaagaaaagagaggatatg
tgctgcgagcagctgaagttactgagaccagcgcatacgagaactcttctccccatctgc
catggcaaattacaaggtctgattcagtcaggggagaagaggctgaatattcggccggtg
cttcaaaaacacatagaccatctgaaggagcttactatggatttaccttctggtgtacct
cacctgctattaacccacacattaccagtgaggaaacgtcttaaacagcctaagagtcag
ttcaggttacggaggacacctctggggtcagaggtcacacatctggagctagcagtggtg
gtgggtccagatgtctatgatgctcataggcaagacactgagagatacatcctgacaaac
ctcaacattgcctctgagcttcttagagatgttactctcggtgccagtataagagttaat
cttgtccgtatggtcattctcacagagccaaagccagacatccagatctccgaaaacatc
acttcttctctaaaaagtgtgtgcaagtggggtcagaaggtcaaccctgatgctgacact
gaccctttacatgcagatctgctgttatacattaccaggtttgatctggtgttacccaat
gggaataagcttgtgagaggtgtgacccagctgggcggagtctgttcctctcaatggaac
tgtgtgattacagaggatacaggctttgatcttggcatcaccatcgctcatgagattggc
cacagttttggcataaatcatgatggaatagacaacacatgcagctccagtgggtttatg
atggcatctgatggaggttataacagtgttgatctcacatggtcccagtgcagcagagct
cagctccacaacttcttcagtgccgggaaggcggagtgtgtgaaggatgtgccggtgctg
ggtgcttcagtgcaggactggaggcctggtctcttctatggagtggatgatcagtgccgt
atagcgtttggcagctcggctactgcttgctctttcactaatggtgatatggcaacctgt
cgtgttttgtcctgccatatcaaccctcgggaccgtagctcatgcactcgtctccttgtt
ccactcttggacgggacggagtgtgggcccagtcagtggtgtttgaagggccggtgtgtg
tctccttctactttgggttcctccatgatggttcacggctcatggtcttcatggtctgaa
ttgtctgtctgctcaagaacatgtggaggaggaatcacttaccgcaggagacagtgcaac
aaccccaggccagcctttggtggtaccgtgtgtaaaggacaggacacagaagctgaactt
tgtaatcggcagctgtttggctgtgatggagtaatgcattctgggaaggtggaggatgtg
tgtggggtgtgtgggggtaatggctccacctgtcagttcatctcaaacacctattcaggc
ggagaagctggagagtatgtcacattcctcagtcttcctctgaacgcctctcaggttcat
gtgattaacacgaagccggtttttacacaccttgcggtgttatcaaatgataaatatgtg
gtgtctggagatggaagcccaggcctgagcatcacatacccctcacctctggagaagagc
cccataatctataacctgttcctcacacctgaccacctgcctcaaactgaagagctcacg
atctctggaccaatcacagacaaaatccacatacaggtgtttcggaaatacgggcaagag
tatggagaccttaccaccccaaacatctcataccagtactactcgtctgaagctgtttca
gttgagagagctgctgaaggcagatggtccactgtcatatctgcatgctcagtcacctgc
ggcacaagcatccagaaaatcagtcagctctgtgtggatggtctcacactcaagcgtctg
gaagatgagctctgtagttcacaccctcgaacaccatatcagctgcagccctgcttccag
cccgactgcccacccagatggcaggtgtccgagcctggcgagtgttcggctgtgtgtgga
cccggggaggctcagagaacagtgtcgtgtgtccgctcacatcatggatctgattctgag
gttaaccaaaacctgtgccctgaacccaaaccgccagaacacgttccctgtgtggtggac
gtttgtcctgtcggctgggattcccaaagagagacccagctgatccgtacagacacccac
ataatgccccgctccagaatggttccagtttatgtttggagtcctgtgattggccagtgc
tcaaagacctgtggggcaggatctcagcaggtttggttctcctgtgtggatcaccaatca
cgtctagaagtcccagagttcctttgtgatcataccaataaaccagagatgtacgcccag
ccctgcagcctatcaatatgtcctgctacgtggcgctacatgcagggcccgtgcagtgtg
tcttgtggaggtggtgtagcaaagagagtcctgtactgttcccagatggtgcagggagga
gacggaaacacggatctggtggtgggagaatctgcttgtcagtctgtggccagaccttca
gaggtggtggagtgtaatactgaagcctgtcctaccaggtggcaggcgggagagcagggt
gactgttcggtgtcatgcgggatgggtgtagctgtgaggagtgtgcgatgtgttcagtat
gaaggaggaatagagagggtcgtggaggagggccggtgtgacccaggaaacaagcctccc
gtcactgcaccatgcttcacacaagtctgttccttcaactgggacgtgcatgaatggagt
gagtgctcagtgtcatgtggtgatgggatccagtctcggaccgtgtcctgcatgggccca
tccagccctcttcctgtcagtccctttctttgcctccacttgccaaaacccatcaccatc
caggcctgctatagccctgactgttccttagctcagacctccacaccagagcccaacagc
actcacatgcagtcagaggcccggagaggagaggggacatggagaaccacaccagctcca
gctccagctcctgctccagctgtcagaatgatgacgatgaggaagagtttctcagccatc
gtgcctacagcagacgtgatgagaagcaccatgagcacaacaacagaaccaccacagacc
agtttctgtgggcaactcctgcttcaagactcaggaactatcgatctgcgcaacgtcact
caggccaggtgtatatttgcaattggccgacctcttgatgaggttattcagatcaaaatc
atatccagcactcttaactgccggcagaaggagaatatcgccctgtatgacagactcatc
ctgatgcgtctctgtgagaggatgaccagtaaaatgctgaaatcacgatcaaatgtccta
ctggtgcgccagagccgcctgacccccggcaatggagtgctgctattttatcagagcata
aagaacaaaaaaagccaccatggagagtgtgacgttcagctgttctctccgtctgggctc
attgagaatccgatcaagagcgcagccacctccacctctaacactcagagctgtcgcgtg
ttcatcgatgctccacctgctttcaggattcagatcagagcgctttctgtgctcaacaac
accgatacaaactccacatacatactgattcgggatgtggatgccttaaagacgaccatc
ttcagaggaactcggctcttcctgtggagctcctcgggaagcagggctgaagtggaattc
catggggagtaccagcaaatcaagggcatgttcagggccgagtattcatacattaaccct
tctgaagaacaaccagtgtag

DBGET integrated database retrieval system