KEGG   Sinocyclocheilus rhinocerous: 107727002Help
Entry
107727002         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04068  FoxO signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04933  AGE-RAGE signaling pathway in diabetic complications
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107727002
   04370 VEGF signaling pathway
    107727002
   04068 FoxO signaling pathway
    107727002
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107727002
   04218 Cellular senescence
    107727002
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107727002
   04621 NOD-like receptor signaling pathway
    107727002
   04622 RIG-I-like receptor signaling pathway
    107727002
   04625 C-type lectin receptor signaling pathway
    107727002
  09152 Endocrine system
   04912 GnRH signaling pathway
    107727002
   04914 Progesterone-mediated oocyte maturation
    107727002
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107727002
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107727002
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107727002
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107727002
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107727002
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107727002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH Haspin_kinase FTA2 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 107727002
NCBI-ProteinID: XP_016392224
Position
Unknown
AA seq 359 aa AA seqDB search
MASPLKARFYRLEIQKTTWDVPDRYTSLKPVGSGAYGTVCSAIDQKTKEKVAIKKLYRPF
QSLIHAKRAYRELRLLRHIQHDNVICLLNVFTPDSTLEKFDTFYMVMPFVAQDLGHIMKR
KRLTSKVITYLFYQILRGLKYIHSAGIIHRDLKPSNLAVDENCELKILDFGLARHAETEM
TGYVVTRWYRAPEVIFNWMHYTQTVDVWSAGCILAEMITGEVLFPGSDSIDQLKKILNLT
GTPSSTLVQKMQSKDAQSYVRSLPVQKKKAFKEVFSGMDPNAIGLLEGMLVLDSEVRLTA
KNGLSHPYLSEFHDPENEPVSPAYDDSFESLDLAVSEWKSLIHMEIMTFDPDNPRVTAT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacctctaaaagcgcgattctacagactggaaatccagaaaactacatgggac
gttcctgaccgatacacctcactcaagcccgttggctctggagcctatgggacagtgtgt
tctgcaattgaccagaagacaaaggaaaaggtggccattaaaaagctatacagaccattc
cagtctctgatccatgctaaacgtgcctacagagagctccggctgctccgtcatatccag
cacgacaatgttatctgcctccttaatgtcttcacccctgattccacactggagaaattt
gatactttctatatggtgatgccatttgtcgctcaggatcttgggcacataatgaagagg
aaacggttaaccagcaaagtcatcacatacctgttctatcagatactgcgaggactcaag
tacatccattctgctgggatcatacatcgggatcttaagcctagtaaccttgcagtggat
gaaaactgtgaattaaagatcctggactttggactggcgagacacgctgaaactgagatg
acgggctatgttgtgacacgctggtacagagcccctgaagtcattttcaactggatgcat
tacactcaaacagttgatgtttggtctgctggctgcatcctggctgagatgataacagga
gaggtgcttttcccaggcagtgacagtattgatcagctgaagaagatcctcaacttgaca
ggcacaccaagctcaacgcttgttcagaaaatgcaaagcaaagatgcacaatcatatgtc
cgctcacttccagtacaaaagaaaaaggccttcaaagaggtcttttctggtatggatcct
aatgccatcggcctgttggaaggcatgctggttttagactcggaggtcagacttacggca
aaaaacggtctttcgcatccatatctttctgagttccatgaccctgaaaacgagcctgtg
tctcctgcgtatgatgattcctttgagagtctggatctggctgtcagcgaatggaagagt
cttatccacatggagatcatgacatttgacccagacaaccccagagtgactgcaacataa

DBGET integrated database retrieval system