KEGG   Sinocyclocheilus rhinocerous: 107728731Help
Entry
107728731         CDS       T04916                                 

Definition
(RefSeq) TGF-beta receptor type-1-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04060  Cytokine-cytokine receptor interaction
srx04068  FoxO signaling pathway
srx04144  Endocytosis
srx04218  Cellular senescence
srx04350  TGF-beta signaling pathway
srx04371  Apelin signaling pathway
srx04520  Adherens junction
srx04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107728731
   04350 TGF-beta signaling pathway
    107728731
   04371 Apelin signaling pathway
    107728731
   04068 FoxO signaling pathway
    107728731
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107728731
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107728731
  09143 Cell growth and death
   04218 Cellular senescence
    107728731
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107728731
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107728731
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107728731
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107728731
Protein kinases [BR:srx01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107728731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107728731
NCBI-ProteinID: XP_016394507
Position
Unknown
AA seq 415 aa AA seqDB search
MRVMMMRRRRMMMMMMDAVPCRLVFLALLFGARIQHTEALQCYCHRCPNHTCATDGLCYV
SITKSGGVTTQQSWCISENELIPRDRPFVCAPSAKHDSGIYPMCCDTDWCNKNPDLTSFP
GQTHLYFFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNK
DNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLSLSTASGLAHLHMEIVGTQGKPA
IAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSI
NMKHFESFKRADIYAMGLVFWEIASRCSIGGIHEDYQLPYYDLVQSDPSVEEMRRVVCEQ
KLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgatgatgatgaggaggaggaggatgatgatgatgatgatggatgcagtaccg
tgccgtctggtgtttttagcgctgctctttggagccaggatccagcacactgaagcctta
cagtgctactgtcaccggtgcccgaaccacacgtgtgccacggacggcctgtgttacgtg
tccatcactaaatccggcggagtgaccacacagcagagctggtgcatcagcgagaacgag
ctgatcccgcgagaccggcccttcgtctgcgctccctccgccaaacacgactccggcatc
taccccatgtgctgcgacaccgactggtgcaacaagaaccccgacctcacctcattccca
ggtcagacgcacctttacttcttcggggaggtgtggaggggcaagtggagaggagaggag
gtggccgtcaagatcttctcctccagagaggagcgctcctggttccgcgaggctgagatc
taccagaccgtgatgctgcggcacgagaacatcctcggcttcatcgccgccgacaacaaa
gataacggcacgtggacgcagctgtggctggtgtcggactatcacgagcacggctctctg
ttcgactatctgaaccgctacacagtgacggtggagggcatgatcaagctgtctctgtcc
acagccagcggcctggcgcacctgcacatggagatcgtgggaacgcaaggcaagcctgct
atcgctcacagggatctgaagtccaagaacatcctggtgaagaagaacggcacgtgctgc
atcgcagacctgggtttagctgtgcggcacgactccgccaccgacaccatcgacatcgca
cccaaccacagagtgggcaccaaacggtatatggctccagaagtgcttgacgattcaata
aacatgaagcactttgagtctttcaagagggcagacatctatgccatggggctggtcttc
tgggaaattgccagcagatgttctattggaggcattcatgaggactaccagctgccgtac
tatgacctggtgcagtccgacccgtcggtggaggagatgaggagagtcgtgtgcgaacag
aaactacggcccaacatcccaaacagatggcagagctgtgaggctctgcgtgtgatggcg
aagatcatgagggagtgctggtacgccaacggagcggcccgtctcacagccctgcgcatc
aagaagacgctgtcccagctcagccagcaggagggcatcaagatgtag

DBGET integrated database retrieval system