KEGG   Sinocyclocheilus rhinocerous: 107732491Help
Entry
107732491         CDS       T04916                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00510  N-Glycan biosynthesis
srx00513  Various types of N-glycan biosynthesis
srx01100  Metabolic pathways
Module
srx_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107732491
   00513 Various types of N-glycan biosynthesis
    107732491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:srx01003]
    107732491
Enzymes [BR:srx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     107732491
Glycosyltransferases [BR:srx01003]
 Glycan extension
  N-Glycan
   107732491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 GNT-I Pho88
Motif
Other DBs
NCBI-GeneID: 107732491
NCBI-ProteinID: XP_016399325
Position
Unknown
AA seq 413 aa AA seqDB search
MRFRLLKKNFIAFLVILIVFIMLFYTIRRTKDETNVEVTEKEVSQTAIMVKFDYGTIENM
RKSVYDSNYRQFIQNRDKFPLDPEVVVVVQVHNRPAYLKMLIQSLEKVTGIQNTLVIFSH
DYFSEEISDMVKGIGFCKVLQIYFPYSIQLYPNEFPGQDPEDCPRDISKEDAVKKGCSNA
EHPDSYGHYREASITQTKHHWWWKLHFVFERVRVLRGYNGFVVVIEEDNYLLPDFHEYFK
SMAELRKTKCGDCDILAVGNHDGLSGFHELSSKTETAGWLSTKHNIGMGISRELYYKLMG
CNHAFCTYDDYNWDWTLQSLSGTCISKPLKVLVALGSRVLHTGDCGLHQKEDCRPEKAQE
RVDEVLKEAQTALFPPALTLTDLGPVEHQPHMKNGGWGDVRDHTLCINYAARL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagattccggttgttgaagaagaactttattgcgttcctcgtcattttaattgtgttt
ataatgttgttttacaccatacgacggactaaagacgaaacaaacgtggaggtgactgaa
aaagaggtctcacagactgctataatggttaaatttgactacgggaccattgagaatatg
aggaagtctgtctatgacagcaactaccgccagttcattcagaatagagacaagtttcca
ttggatcctgaggtggttgtcgtcgtgcaagtccacaatcgtccggcgtacctcaaaatg
ctcatacagtccttggaaaaagtcactggaatacaaaacacgcttgtgatattcagtcac
gactatttctcggaggaaatttccgatatggtcaaaggaatcggcttctgcaaggtcctc
cagatctatttcccctacagcatccagctgtatcccaacgaattcccaggacaggatccc
gaagattgtccgagagacatatcgaaggaggatgccgtaaaaaagggctgttcgaacgca
gagcacccggattcgtacggacactacagggaagcgtccatcacccaaaccaaacaccat
tggtggtggaagctgcatttcgtgttcgagcgagtgagggttcttcggggatacaacggc
tttgtcgtcgtcatcgaggaagacaactaccttctcccagatttccacgaatacttcaaa
tccatggccgagctcaggaaaaccaaatgcggggattgcgacatcctcgccgtaggcaac
catgacggtttatcaggcttccacgagctttccagcaaaaccgagacggcaggatggctg
tccaccaagcataacataggaatgggcatctccagagagctctactacaaactgatggga
tgcaatcatgcattctgcacctatgatgattataactgggactggaccctgcagagcttg
tctggtacatgcatctccaaacctctcaaggttctggtggctcttggaagtcgggttctt
cacacgggagattgcggcctgcatcagaaggaggattgccggccggaaaaggctcaggag
agggtggatgaagtgcttaaagaggcgcagacggctcttttccctcccgctttgaccttg
acggaccttgggccggtggagcatcagcctcacatgaagaacggaggatggggggacgtt
cgcgaccacacgctgtgcatcaactacgcagctcgactctga

DBGET integrated database retrieval system