KEGG   Sinocyclocheilus rhinocerous: 107732588Help
Entry
107732588         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4-like
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107732588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107732588
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107732588
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107732588
Protein kinases [BR:srx01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107732588
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107732588
   Centrosome duplication proteins
    Regulators of centriole replication
     107732588
  Sister chromatid separation proteins
   Polo kinases
    107732588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Pkinase_fungal Kinase-like Ribosomal_L28 Haspin_kinase Glycos_trans_3N Kdo
Motif
Other DBs
NCBI-GeneID: 107732588
NCBI-ProteinID: XP_016399441
Position
Unknown
AA seq 900 aa AA seqDB search
MSVSIGDKIEDFKVLTLLGKGSFACVYRAKSVNTGLEVAIKMIDKKAMHKAGMVQRVINE
VEIQCRLKHPSVLELYNYFEDSNYVYLVLEMCHNGEMSRYLKERKNPFTEEEARHFMHQI
VKGMLYLHTHGIMHRDLTLSNLLLTTSMNIKIADFGLATQLKLPSEKHFTMCGTPNYISP
EVATRSAHGLESDVWSLGCMFYAFLTSRPPFDTDTVKHTLNKVVLGEYQMPTHISAEAQD
LIQQLLQKNPALRPSLSAVLDHPFMTHARPTASKDSGSSDGGSIDSGIATISTASNATNS
SSSSRLQRETRQVIGQPLPNRMVPIPSHSHHSTSSSFKSGRDWQPNLQDDLSRMGIGKVP
MGADSRRPHSRYLRRAHSSDRSGAGFSNTPQEAELERCHSEEMLPGSGRLFSSTSSYRNM
PHGYSEQGRLPSPPVKQPANPGSSFSTSTHSMRTQMPDSQTQAWFSCDGKIPIRIQSLSG
KSPPPFDTDTVKHTLNKVVLGEYQMPTHISAEAQDLIQQLLQKNPALRPSLSAVLDHPFM
THARPTASKDSGSSDGGSIDSGIATISTASNATNSSSSSRLQRETRQVIGQPLPNRMVPI
PSHSHHSTSSSFKSRRDWQPNLQDDLSRMGIGKVPMGADSRRPHSRYLRRAHSSDRSGAG
FSNTPQEAELERCHSEEMLPGSGRLFSSTSSYRNMPHGYSEQGRLPSPPVKQPANPGSSF
STSTHSMRTQMPDSQTQAWFSCDGPFKRPADLSSHSSSGSFHSGRGPVGTQTSCGDKPSG
LHSQQQPNLFPHNNQGPCREDVFGSGHVSESQGYSDAQFLGPPLSKGKANTEKKEKVFPK
KSFPPLCAVRLKPIRQKTKNAVVSILDSGEVCMELLKGQGTQERVKEVLRISHDGSMVRD
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctcaatcggtgacaaaattgaggacttcaaggttctcaccttgttgggtaaa
ggctcttttgcatgcgtgtacagagcaaaatctgtaaacacaggcttggaggtggcaatc
aaaatgattgacaagaaggccatgcacaaagctggcatggtgcagagagtcattaatgag
gtggagattcagtgtcggttaaaacatccgtcggttcttgagctgtacaattactttgag
gacagtaattatgtgtacctggttctggagatgtgtcacaatggggaaatgagccgctac
ctgaaggagaggaaaaacccttttacagaggaagaggcgaggcacttcatgcatcagatt
gtgaagggaatgctgtacctccacactcatgggatcatgcacagggacctgaccttgtcc
aacctcctgctcaccaccagcatgaatattaaaattgcagactttggtttggcaacgcag
ctcaagcttcccagtgagaagcacttcaccatgtgtgggacaccaaactacatttcacct
gaggtggctacacgcagcgctcacggcctggagtcggatgtttggtccctgggctgtatg
ttttacgccttcctcacgagcagacctccctttgacacagacactgtcaaacataccctc
aataaggtggttctgggagaatatcagatgcccactcacatatcagcagaagctcaggac
ctgattcagcagctcttgcaaaagaacccggccctcaggcccagtctctccgctgtgctg
gaccacccctttatgactcatgccaggcccactgcaagcaaagactctgggagcagtgat
ggagggtccatagacagcggcatagccaccatatccacagcctccaatgctaccaatagc
agcagcagcagccggctacagagggaaacaaggcaggtgattggtcagcctttacccaat
cgcatggtgccaatccccagccactcccatcattccaccagctccagttttaagagcggg
cgagattggcagccaaatttacaagatgatttatcaaggatgggtataggtaaagttccc
atgggtgctgacagcagaaggcctcattctcgctacttgagacgggctcactcatcagat
cgatctggtgctgggtttagcaacactccacaggaggcggagctggagagatgccactct
gaagagatgcttccagggtctggacgattattttcatcaacctccagttacagaaatatg
ccccatggctactctgagcaagggcgcctaccttctccacctgtaaaacagcctgcaaat
ccgggatcatctttctctacatccacccattcaatgaggacacaaatgcctgattctcaa
acacaggcctggttcagctgcgatggtaaaattcccatcagaattcagagtttaagcggt
aaatctccacctccctttgacacagacactgtcaaacataccctcaataaggtggttctg
ggagaatatcagatgcccactcacatatcagcagaagctcaggacctgattcagcagctc
ttgcaaaagaacccggccctcaggcccagtctctccgctgtgctggaccacccctttatg
actcatgccaggcccactgcaagcaaagactctgggagcagtgatggagggtccatagac
agcggcatagccaccatatccacagcctccaatgctaccaatagcagcagcagcagccgg
ctacagagggaaacaaggcaggtgattggtcagcctttacccaatcgcatggtgccgatc
cccagccattcccatcattccaccagctccagttttaagagcaggcgagattggcagcca
aatttacaagatgatttatcaaggatgggtataggtaaagttcccatgggtgctgacagc
agaaggcctcattctcgctacttgagacgggctcactcatcagatcgatctggtgctggg
tttagcaacactccacaggaggcggagctggagagatgccactctgaagagatgcttcca
gggtctggacgattattttcatcaacctccagttacagaaatatgccccatggctactct
gagcaagggcgcctaccttctccacctgtaaaacagcctgcaaatccgggatcatctttc
tctacatccacccattcaatgaggacacaaatgcctgattctcaaacacaggcctggttc
agctgcgatggaccgtttaagaggccggcggacctgagcagtcacagcagcagtggtagt
ttccactctggacgagggccagtcgggacacaaacctcctgcggtgacaaacccagcggc
cttcactctcagcagcaaccgaacctttttcctcacaacaatcaggggccctgcagggaa
gatgtgtttggatcaggacacgtgtcagaatctcaaggctactcggacgcacagtttctg
ggtccacccctctccaaaggcaaagcaaacacagagaagaaggagaaagtgttccctaag
aagagcttcccaccactctgtgctgtcagactcaagcctattagacaaaagaccaaaaac
gctgtggtcagtatcctggattctggagaggtgtgtatggagctgctgaagggacaagga
actcaggagagagtcaaagaagtacttaggatatcccatgatggatccatggtgagggac
taa

DBGET integrated database retrieval system