KEGG   Sinocyclocheilus rhinocerous: 107733544Help
Entry
107733544         CDS       T04916                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:srx01002]
    107733544
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107733544
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107733544
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107733544
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107733544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Abhydrolase_2 Say1_Mug180 Peptidase_S15
Motif
Other DBs
NCBI-GeneID: 107733544
NCBI-ProteinID: XP_016400695
Position
Unknown
AA seq 384 aa AA seqDB search
MRKRKGSADHDSSFTGNVTLLDGSSDLKQCHKKTDAASDPGGSGTGMGRRYRRGGLIWRL
RRILIWVLGIYIAIPVIIKVCPSIQAKLVFLNFVRVPYFIDLKRPEDQGLNHTRNFYLQP
EEGINIGVCHTVPSVMWREAQAKDAEWYDKSFQSSHPVILYLHGNAGTRGGDHRVQLYKV
LSSLGYHVVTFDYRGWGDSEGSPSEKGMTSDALFLYQWIKQRIGQKPLYIWGHSLGTGVA
TNLVRRLCDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDSITANDIRF
ASDENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFPSSLGYRH
KFIYKSPQLPNILSDFLSAPHPHV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcgaaaaggcagcgcagaccatgacagctcgttcacgggtaacgttacacta
ctggacggcagctccgatctaaagcagtgccacaaaaaaacagacgctgcttctgatcca
ggaggttcggggacagggatggggagacgctacaggaggggtggtctgatatggaggcta
aggaggatactgatctgggtgctgggaatctacatcgccatccctgttatcatcaaagtc
tgtccatcaatacaagcaaaattagtatttttaaactttgtgcgagtgccgtattttata
gatctgaagagaccagaggatcagggcttgaatcacactcgcaacttctacctgcagccc
gaggagggaatcaacattggagtgtgtcacacagtaccttcagtgatgtggagggaggct
caggcaaaagatgctgaatggtatgacaaaagcttccagtccagtcatccagtcatcctg
tatcttcatggcaatgctggaacaagaggaggggatcacagggttcagctgtacaaggtt
cttagttcattaggctaccatgtagtcacatttgattatagaggttggggtgactctgag
ggcagcccttcggagaaaggcatgacgtcagatgctctcttcctctaccagtggataaag
cagcggattggccagaagcccctgtacatctggggtcactcgcttggcacaggagtggcc
actaacctagtgagacgtctgtgtgacaggggaacgcccccagacgccctaattttagag
tcaccctttaccaatatcagagaggaagccaagagccatcccttctctatggtttacaga
tatctgccaggctttgactggttcttcctggattctataactgcgaatgatatccgattt
gccagtgatgaaaatgtcaaccacatatcctgtccggttctgatactgcacgcagaagat
gacacagtcgtacctttccagctgggaaagaagctatatgatttggcggctcagagcaag
agtctgaacggtcataaggttcagttcatcccgtttcccagctctctgggctacagacac
aagttcatctacaagagcccacagctaccaaatatactcagtgattttctcagtgcgccg
catcctcacgtgtag

DBGET integrated database retrieval system