KEGG   Sinocyclocheilus rhinocerous: 107733677Help
Entry
107733677         CDS       T04916                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107733677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:srx03012]
    107733677
Translation factors [BR:srx03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    107733677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 107733677
NCBI-ProteinID: XP_016400893
Position
Unknown
AA seq 1158 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVIKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTETAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSKVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFALSKKPPKPQLMANYYNKVSTVFWKSGNALFHACTLHRLY
HLSREMRKNLTPEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQSPPTRQSLINDMVRFNLLQYVVPEVKELYNWLEVDFHPLKLCGRVTKVLNWVRDQVEK
ESDLQHYVPHLQNNTILRLLQQVAQIYQSIEFSRLASLVPFVDAFQLERSIVDAARHCDL
QSLRGLLHWARLLRFEPGHYCSWCPPPCWSGFTLNLILSNSGVFALSYVLKQEAKEREKE
RIMQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKK
ELQERLKNQEKKIDYFERAKRLEEIPLIKKAYEEQRIKDMELWELQEEERISNMKMEREK
ALEHKQRMSRMMEDKENFLSKIKAARSFIYEEKLKQFQERLVEERKKRLEERKKQRKEDR
RNAFYRQKEEEAQRIHEEQLKKEREERERLEQEQREEEEREYQERLRKLEEQERKQRARQ
QEIEERERRKEEERKAPEEKPTKDWGEREEGGWRKRGEGDSEWRRPVADREWRQEEREGH
EDNDREDRDREVPFRRGGESSRRGGSDDRGLRRGFDDERGPRRGGDDDRGPKRGFDDDRG
PRRGFDDDRGPRRGDDDRGPRRGMDDDRGPRRGFDDDRGPRRSMDEPRGPRRGADDDWGP
RRGGDDERGGRRGMDDSGPRRGDDPKPWKPLGRPGVSSDGGWREREKAREESWGPPRDTG
HDDGEPEGDDRHEGDRFRDRRPPREEGGGWRRGGAEEQSSWRDSRREEFDRDDRRERRDM
RDRRDDRDNRGPQRDPNEGGSWRRGGDERKDEREAPPRPHDRDRDGGEKSTWRSDKDKEN
LRRTKNETDDDGWTTVRR
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgccagcctattttcagagaccggagaacgctcttaagcgagcaaacgagtttcttgaa
gttggtaaaaagcagccagctttggatgtgctctacgatgtcatcaagagcaaaaaacat
cgaacatggcagaagatacacgagcctatcatgctcaaatacttggagctctgtgtggac
ctgcgcaagagccacttggcaaaggagggactgtatcagtacaaaaacatctgtcaacag
gtgaatatcaaatctctggaggatgtggtccgtgcttacctgaaacttgcagaggagaag
actgagacagcgaaagaggagtctcagcagatggtgctggacattgaggatctggacaac
attcagaccccagaaagtgttctgttgagtgccgtcagtggtgaagacactcaagaccgc
actgacagacttctgctgacgccttgggtaaagttcttgtgggagtcgtaccgccagtgc
ctggacctgctaaggaataactccaaagtggagcgcctttaccatgacattgctcagcaa
gcgtttaagttttgcctgcagtacacccgtaaagcagagttccgtaagctgtgtgacaac
ctgcgaatgcatctgggacagattcaacgacatcacaaccagagcactgccattaacctg
aacaatcccgagagccagtccatgcatcttgagacacgtctggtccagctggacagcgct
attagcatggagctgtggcaggaagcattcaaagcagttgaagacatccatggattgttt
gccctctcaaagaagccccctaaaccccaacttatggccaattactacaataaggtgtcc
actgtattctggaagtctggcaatgccttattccatgcctgcaccctacacagactttat
cacctctcccgggaaatgcgcaagaaccttaccccagaagagatgcagagaatgtccact
cgagtgcttttggccactttgtctattcccatcactcctgagcgtactgatatcgctcgt
ctgttggacatggatggcatcattgtagagaaacaacgcagactggctactttgcttggc
cttcagtctccacccacccgccagagtctcatcaatgacatggtgagattcaacctgctt
cagtatgttgttcctgaagtcaaagagctctacaattggttggaggtggacttccaccct
ctaaaactttgtggaagagtgactaaagtgctgaactgggtgagggaccaagttgagaaa
gaatcagacctgcagcattatgttcctcacttgcagaacaacaccatcctcagactgcta
caacaggtggctcagatctaccagagcattgagttcagcaggttagcatctctggtacca
tttgtcgatgctttccaactggagcgctcaattgtagatgcagcacggcactgtgaccta
cagtctctaagggggcttttacactgggcacgtttgctgcggtttgagcccgggcactat
tgttcctggtgccccccgccatgttggtctggtttcacactaaacttgattctatcgaac
tctggtgtgtttgcattatcttacgtccttaaacaggaggccaaagagcgagaaaaggag
cgcatcatgcaagaacacgagcaaatcaaaaagaagacagtgcgtgagcgactggagcag
atcaagaagactgagctgggagccaaggcctttaaagacattgatattgaggatctggaa
gagctggaccctgacttcatcatggccaaacaggtagaacaactagaaaaagagaagaaa
gaacttcaggagcgtctgaaaaaccaggaaaagaagatcgactactttgagagagccaag
cgccttgaggagattcccctgatcaagaaagcctatgaggagcagcgcatcaaagacatg
gagttatgggagctgcaggaggaagagaggatcagcaatatgaagatggagcgtgagaag
gcgctggaacacaaacagagaatgtcaaggatgatggaggacaaggagaacttcctgtcc
aaaattaaagctgctcgaagcttcatttatgaggaaaaactcaagcagttccaagaacgt
ttggttgaggagaggaagaagcgtcttgaggagcgaaagaagcagcgtaaggaggacaga
cgaaatgccttctatcgccagaaagaagaggaagctcagagaatccatgaggaacagctc
aagaaagagcgggaagagcgtgaacgcttggaacaggagcaaagagaggaggaagaacgc
gaataccaggagcgcttgcgtaagctggaggaacaggagagaaagcagcgtgcccgtcaa
caggaaattgaggagcgtgaacgccgcaaggaggaggaaaggaaggcaccagaagaaaaa
cccaccaaggactggggtgaacgggaagaaggaggctggaggaagcgaggtgagggtgat
tcagaatggcgacgtcctgttgctgaccgtgaatggcgtcaagaggagcgtgaaggccat
gaagacaatgatcgagaagaccgtgaccgtgaagtgcccttccgaagaggaggagaaagt
tctcgtcgtggtggttcagatgacagaggactccgccgtggttttgatgacgaacgaggt
ccgcgccgaggaggtgacgatgaccgtggacctaaacggggctttgatgatgaccgtggt
cccaggaggggctttgatgatgaccgaggaccccgaagaggcgatgacgaccgtgggcca
aggcgtggaatggatgacgaccgtggcccaagaagaggctttgatgacgaccgtgggccc
cgtagaagcatggatgaacccagagggcctcgacgtggggcagatgatgactggggcccc
agaagaggaggggatgatgagaggggaggccgcaggggtatggatgactctggcccacgt
cgtggagatgaccctaaaccctggaaaccacttgggagaccaggtgtgagctcagatggt
ggatggagagagcgagagaaggctcgggaagaaagctggggacctcctcgtgatactggc
catgatgatggtgagcctgagggagatgaccgtcacgagggagatcgatttagagatcga
cgccctcccagggaagaagggggtggctggagaagaggtggtgctgaggagcagagcagt
tggcgtgactctcgccgtgaagaatttgaccgtgatgatcgtcgtgaacgccgtgacatg
agggaccgcagagatgaccgtgataacagaggcccccagagagaccctaatgaaggtggt
tcatggcgtcgtggtggcgatgagcgcaaggacgaaagagaagctcctcccagaccacat
gaccgggaccgtgatggcggtgagaagagcacctggcgctctgacaaagataaggaaaat
ctgcgccggaccaagaacgagacggatgatgatggctggaccactgtccgccgctaa

DBGET integrated database retrieval system