KEGG   Sinocyclocheilus rhinocerous: 107734232Help
Entry
107734232         CDS       T04916                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04270  Vascular smooth muscle contraction
srx04371  Apelin signaling pathway
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107734232
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107734232
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107734232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107734232
   04031 GTP-binding proteins [BR:srx04031]
    107734232
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107734232
  Exosomal proteins of colorectal cancer cells
   107734232
GTP-binding proteins [BR:srx04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    107734232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 Roc FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 107734232
NCBI-ProteinID: XP_016401620
Position
Unknown
AA seq 388 aa AA seqDB search
MYLSIHEVSTTKMADFLPFRTAIVCIPNCLLSSGEIDQVRKSKEIDKRLSREKTYVKKLV
KILLLGAGESGKSTFLKQMRIIHGQDFDQRAKEEFRATIYSNVIKGIRVLVDAREKLHIP
WGDPENQVHGETVMGFDTRSSMMAKGMVETKVFLNYLPCIRALWHDSSIQNAYDRRREFQ
LGESVKYFLDNVDKLGQLDYLPSQKDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSE
RKRWFECFDCVTSILFLVSSSEYDQVLMEDRQTNRLTESLNIFETIVNNRVFANVSIILF
LNKTDLLEEKVTNVNIKDYFPEFTGDPHNLQDVQKFLVECFRNKRREQQQKPLYHHFTTA
INTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtatctatctatccatgaagtctctactacaaagatggcggatttcctgcccttccgg
actgctatagtatgtattcccaattgtcttctatccagcggcgaaattgaccaagttaga
aagtctaaggagatcgataaacgcttgtctcgagagaagacgtatgtgaagaaactggtg
aagatcttgctgttaggagcaggcgaaagtggcaagtcaactttcctcaaacaaatgcgc
ataattcatgggcaggacttcgatcagcgggccaaagaagagttccgggctacaatctac
agcaatgttatcaaaggtatccgagtgctggtggatgcccgtgagaagctgcacatccct
tggggagatcctgagaatcaggttcacggggagacagtgatgggctttgacacccggtca
tccatgatggccaaagggatggtggagaccaaagtctttctcaactacctgccctgcatc
cgtgccctgtggcatgacagtagtattcagaatgcttatgacagacggagagagtttcag
ctgggtgaatctgtgaagtatttcctggacaatgtggataaacttggacaattggactac
ttgcctagccaaaaggatatactgctggcacgaaagcccaccaagggtatccatgagtac
gactttgaaatcaagaatgttcctttcaagatggtggatgtgggggggcagcggtcggag
cgcaagcgatggtttgagtgcttcgactgtgtgacctccatccttttcctagtctcatcc
agtgaatacgatcaggtgctcatggaagaccgtcagaccaacaggctcacggagtcactc
aatatcttcgagactatcgtcaacaaccgcgtcttcgccaacgtctccatcattcttttc
ctcaataagacagacttgctggaagaaaaagttacgaatgtgaacatcaaggactacttc
ccagagttcacaggggatccccacaatctgcaggatgttcagaagttcctggtcgagtgc
ttccgtaacaagcgtcgtgaacagcagcagaagcccctttaccatcacttcaccaccgcc
attaacacagagaacattcgtctcgtcttccgtgatgtcaaagacaccatcttacacgac
aaccttaaacagcttatgttacaatga

DBGET integrated database retrieval system