KEGG   Sinocyclocheilus rhinocerous: 107736472
Entry
107736472         CDS       T04916                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107736472
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107736472
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 Phage_rep_O
Other DBs
NCBI-GeneID: 107736472
NCBI-ProteinID: XP_016403361
Position
Unknown
AA seq 220 aa
KEVGDKGLWGLVNNAGRSLPMGPSEWMKIEDFENTLKVNMTGVIEMTMNFFPLVKKARGR
VVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDIQNFGVNVCIIEPGFFKTQVTSLEP
IERELHRLWNQLTPEVKESYGDKYLDQYIKIQRLIMNTICDSDLSKVTNCMEHALLAVHP
RTRYSAGWDAKLLWIPLSYMPACIVDIALKLVLPKPAKSV
NT seq 663 nt   +upstreamnt  +downstreamnt
aaagaagttggagataaaggactatggggactcgtgaacaacgccggacgctcccttccc
atgggtccatcagagtggatgaaaatcgaagacttcgaaaacacgctcaaagtcaacatg
actggtgttatcgagatgaccatgaacttctttcctcttgtcaaaaaagcccgtggacga
gtggtgaacgtggcatcagtgttgggaagagtggcagctaacggcggagggtattgcatc
tcaaagtttgcggtggagagcttctctgattgtctcaggagggacatccagaattttggg
gtcaatgtgtgcatcatcgaacctggtttcttcaagacacaggtgaccagcctggagcct
atcgagagggaacttcatcgcctctggaaccagctgacgcctgaagtgaaggagagttat
ggagacaaatacttggatcaatatatcaagatccagaggctgatcatgaacaccatatgc
gactccgacctcagtaaagtgaccaactgcatggaacacgccctgctggccgtccaccca
aggacacgctacagtgcaggctgggatgccaagctcttgtggattcccttgtcttatatg
cccgcttgcattgtagatattgccctgaagctggtgttgccaaagccagcaaaaagtgtc
tag

DBGET integrated database retrieval system