KEGG   Sinocyclocheilus rhinocerous: 107737029Help
Entry
107737029         CDS       T04916                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04060  Cytokine-cytokine receptor interaction
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04218  Cellular senescence
srx04350  TGF-beta signaling pathway
srx04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107737029 (tgfb2)
   04350 TGF-beta signaling pathway
    107737029 (tgfb2)
   04068 FoxO signaling pathway
    107737029 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107737029 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107737029 (tgfb2)
   04218 Cellular senescence
    107737029 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107737029 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107737029 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:srx00536]
    107737029 (tgfb2)
Cytokines and growth factors [BR:srx04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107737029 (tgfb2)
Glycosaminoglycan binding proteins [BR:srx00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107737029 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 107737029
NCBI-ProteinID: XP_016403915
Position
Unknown
AA seq 411 aa AA seqDB search
MNLYVLSLLLTLDLATVAVSLSTCSTLDMEQFKKKRIEAIRGQILSKLKLSSPPEIYPEP
EEVSRDIIAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPAENVISP
THYNPYFRRLRFDMSSMEKNASNLVKAELRIFRLQNSKARVSEQRIELYQILGHKDLTSP
TQRYIDSKVVRTRTEGEWLSFDVTEAVSEWLLHRDRNNGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFVHGGDLKMFKKRRHSGQSPHLLLMLLPSYRLESQHKSHRQKRA
LDAAFCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYNANFCAGACPYLWSADTQHSNI
LGLYNTINPEASASPCCVSQDLEPLTILYYIGKNPKIEQLSNMIVKSCKCS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgtacgtcttgagtctccttctgaccttggatttagccacagtggccgtcagt
ttatccacatgcagcactctggacatggagcagttcaaaaagaagcggatcgaggccatc
cgcggtcagatcctcagtaaactcaagctgagcagtcctccggagatctaccccgagccc
gaggaggtgtcccgggacatcatcgccatctataacagcacacgggacctgctgcaggag
aaagccaacgagcgagcggccacctgcgagagacagcgcagcgaggaggagtactacgcc
aaagaagtgcacaagatagacatgcagcccttctaccctgccgagaatgtcatctctcca
acacattacaacccgtacttcaggaggctcaggtttgacatgagctccatggagaagaac
gcctcgaacctggtgaaggcagagctcaggatcttcaggctgcagaactcaaaggcccgt
gtgtctgagcagcggattgagctttaccagattttaggtcacaaggacctcacgtccccc
acgcagcgctacattgacagcaaggtggtgcgcacccgcacggagggcgagtggctgtcg
ttcgacgtgacagaggccgtcagcgagtggctgctgcacagagacagaaacaatggattc
aagatcagcctgcactgtccctgctgcacatttgtgccgtcaaataattacatcatcccc
aacaagagcgaggagctggaggcgcgctttgcaggtatagatgacagctttgtgcacgga
ggggatctgaagatgtttaaaaagcgccgtcacagcggtcagtctccacacctgctgctg
atgctgctcccatcataccggctggagtcgcagcacaagagccacagacagaaacgcgct
ctggacgctgccttctgctccaggaatgtgcaggacaactgctgtttacgctctctctac
atcgacttcaagaaggatctgggctggaggtggatccacgaacccaaaggttataacgcc
aacttctgtgcgggagcctgtccgtatctgtggagcgcagacacccaacacagcaacatc
cttggcctctataacaccatcaatccagaagcgtccgcatctccttgctgtgtgtctcag
gatctggaacccctcacaatcctttactacatcggaaaaaaccccaaaatcgagcagctc
tccaacatgattgtcaagtcctgcaagtgcagctag

DBGET integrated database retrieval system