KEGG   Sinocyclocheilus rhinocerous: 107738520Help
Entry
107738520         CDS       T04916                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00020  Citrate cycle (TCA cycle)
srx00480  Glutathione metabolism
srx01100  Metabolic pathways
srx01200  Carbon metabolism
srx01210  2-Oxocarboxylic acid metabolism
srx01230  Biosynthesis of amino acids
srx04146  Peroxisome
Module
srx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107738520
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107738520
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107738520
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     107738520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 107738520
NCBI-ProteinID: XP_016405764
Position
Unknown
AA seq 227 aa AA seqDB search
FGSVVEMQGDEMTRVIWELIKEKLIFPYLELDLHRFQPVLLSAPSHLKHPYSYIQCREEH
RLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGRTVEAEAA
HGTVTRHYRMHQQGKETSTNPIASIFAWTRGLLHRAELDKNAELRVFAEALEAVCVETIE
AGFMTKDLAICIKGMSNVTRSDYLNTFEFLDKLAKNLKIKLSSQPKL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
tttggttctgtggtcgagatgcaaggagatgagatgaccagagtaatatgggagctcata
aaagagaaactcattttcccttatctggagctcgacctgcacagatttcagcccgtatta
ctctcagcaccatctcacctgaaacacccctactcctacattcagtgtagagaagagcat
cggctgattgatgacatggtggctcaggccatgaagtctgaaggtggatttatctgggcc
tgcaagaactatgatggagacgtgcaatcagactctgtagctcagggttatgggtcattg
ggtatgatgaccagtgtgcttgtgtgtcctgatgggcgtacagtagaagccgaggcagct
catggcacggttacacggcactatcgcatgcaccagcagggcaaagagacgtccaccaac
cctattgcctctatctttgcgtggacacgagggctgctgcaccgggcggagctggataag
aacgcagagctgcgggtgtttgctgaggcactggaggccgtttgtgtcgagaccattgaa
gctggtttcatgaccaaggacctggccatctgcatcaagggcatgtctaatgtcacacgc
tctgattacctcaacacttttgagttcttggacaaactggccaagaatctgaagattaag
ttgtcaagccaacccaaactgtaa

DBGET integrated database retrieval system