KEGG   Sinocyclocheilus rhinocerous: 107741092Help
Entry
107741092         CDS       T04916                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04020  Calcium signaling pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107741092
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107741092
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:srx04030]
    107741092
G protein-coupled receptors [BR:srx04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107741092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 107741092
NCBI-ProteinID: XP_016409171
Position
Unknown
AA seq 399 aa AA seqDB search
MRGCEFPREDSESCHGFDLRAPHRNGPLHIYGYMNLSSTGQMPEMEEVDTNESNGLAKRI
ALISFLSLVMLMSVLGNLLVMVAVCKDRQLRICKSFAIILVITPYTVYVTFCLVRTSLDV
LLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRVALMIGGCWIIPTVISFLPIMQGW
NSIGINDLIEKRKFSGNSTVCVFMVNKPYALTCSVVAFYVPLILMVLAYQRIYVTARAHA
RQISMLQRAGGAGNADSADHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFITNVVDPFI
DYSVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGHKRYRRPSILGPGTT
CTATQINGSTHVLKYSALHNGNHTEQEKLSIQNDTESQE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggatgtgaatttccacgggaggattcagagtcgtgccatggttttgacctgcgc
gctcctcacagaaatggaccgctccacatctacgggtacatgaatctgagttccactggc
cagatgcctgagatggaagaagtagataccaatgagagcaacgggttggcgaagaggatt
gctctcatcagcttcctgtcactggtcatgctcatgagcgtcctgggcaacctgctggtt
atggtggccgtctgcaaagaccggcagctcaggatctgcaaatcatttgccatcatccta
gtcatcactccttacactgtttatgtgaccttctgcctggtccgcacctctctggacgtg
ctgctgaccaccgcctccatcctacacctgtgctgcatctctctcgacaggtactatgcc
atctgttgccagccgctggtttacaggaataagatgacaccattgagagtggctctaatg
atcggaggatgctggataatcccaaccgttatttccttcctacccataatgcaaggctgg
aacagtattggaataaatgatttgatagagaagcggaagttctctggcaactccacggtg
tgtgtgtttatggtgaacaagccatatgcgctgacctgctcggtcgtggccttctacgta
ccgctgatcctgatggtgctggcgtaccagcgcatctacgtcacggcgcgggcacacgct
cgacagatcagcatgctgcagcgggccggaggagcggggaacgcggacagcgcggaccac
caacgcaaccaccgcatgcgcaccgagaccaaggcggccaagactctgtgcatcatcatg
ggctgcttctgcctgtgctgggcccctttcttcatcacgaacgtggtggaccccttcata
gactacagtgttcctgagcagctgtgggcggcctgcctctggctgggctacatcaactcc
atgctcaaccccatcctctacgccttcctcaacaagtcctttcgtcgtgccttcctcatc
attctctgctgcggacacaagcgctaccgccgaccttccatcctgggccctggaacgacc
tgcacggccacgcagatcaacggctcgacacacgtcctgaagtattcagctcttcacaat
ggaaaccacactgaacaggagaaactgtcaatacagaacgacacagagtcccaggagtga

DBGET integrated database retrieval system