KEGG   Sinocyclocheilus rhinocerous: 107742642Help
Entry
107742642         CDS       T04916                                 

Definition
(RefSeq) probable cysteine--tRNA ligase, mitochondrial isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107742642
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srx01007]
    107742642
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:srx03016]
    107742642
Enzymes [BR:srx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     107742642
Amino acid related enzymes [BR:srx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   107742642
Transfer RNA biogenesis [BR:srx03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    107742642
 Prokaryotic Type
    107742642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 107742642
NCBI-ProteinID: XP_016411183
Position
Unknown
AA seq 569 aa AA seqDB search
MRLPLALLTDVRLLNSGFRIGHWIHNGVTKTSLLSSCNICSRAERKWIKPVGFDTGVKTY
NSLTKQKEPLVLAQERIATWYSCGPTVYDHAHLGHACSYVRFDILQRILSRLFEINVIHV
MVITDIDDKIIQRSLEQNISPTVLARMHEEEFKRDMQALRVLPPAVYMRVTDNIPQIVAF
IERIIGNGHGYVTSQGNVYFDTQSIGNRYGKLVNLGGIVGELGAQDKRDPRDFALWKASK
PHEPHWESPWGQGRPGWHIECSTIASSVFGSQLDIHSGGIDLAFPHHENEIAQSEAYHQC
EQWGNYFLHSGHLHLKGSVEKMSKSLKNYVTINDFLESYTANEFRLFCLLTRYRSAIDYS
DASTNEARSTLSTISAFCHNAQAYMQGHLLCQPIEEGILWERLSATQSSVRKALADDFDT
PKAVGAIMSLIHHGNCQLQPATKVDGPRCPAVFGAMLSYVREILGVFGVDLLDRKEVHDS
SGVLNNVVEELVHFRSKVRKFALSVGDQASQNPQTGSEIQKRHPQPDRVPLLKACDALRN
NLAPLGVHIKDRGTNSTWEITRGGETRKN
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcctttagcattgcttacagatgtaagactgcttaattctggctttagaatc
gggcattggattcataatggtgttacaaaaacatcattgctgtccagttgtaatatatgc
agcagggcggagagaaagtggataaaaccagtggggtttgacaccggtgtgaagacttac
aacagtctgaccaagcagaaagaacctctggttttggcacaagaaagaattgctacctgg
tatagctgtggacccactgtttatgatcatgcccatctcggtcatgcgtgctcatatgtc
agatttgacattctgcaaaggatcttatccagactttttgaaattaatgtcatccacgtc
atggtcatcactgacattgatgataaaataatacaaagaagccttgagcagaacatctca
cccactgtcctagcaagaatgcatgaggaagagtttaagagggacatgcaagcactgcgg
gttcttcctccagctgtatacatgagggtgacagacaacataccccagattgtagctttt
atagagcgtattatcggaaatggacatggctatgtcacaagtcaagggaatgtctacttc
gacactcagtcaattggtaaccgctatggcaagcttgtgaaccttggaggaattgttggg
gagcttggggctcaggataaaagagatccaagggattttgctctgtggaaagcatccaaa
ccacatgaacctcattgggaatcaccttggggacaaggaagacctgggtggcacattgaa
tgttctacaattgctagttcagtgtttggaagccagttggacatccactctggaggaatt
gaccttgccttcccacatcatgagaatgagatagcccagtctgaggcgtatcatcagtgt
gaacaatggggaaactacttcctgcactccgggcaccttcatttgaaaggaagtgtagag
aagatgtcaaaatccttgaagaattatgtaactataaatgattttctggaatcttacact
gctaatgagtttcgacttttttgccttctgaccagatacagatcagcaatcgactatagt
gatgctagcacgaatgaagcccgatctactctgtccaccatctctgccttctgccacaat
gcacaggcctacatgcagggccacttactgtgccagcctatagaggagggaattctctgg
gagaggttgtctgctacacagtccagtgttcggaaagcactcgctgatgattttgacacc
ccaaaagctgtgggtgccattatgagcctcattcaccatggcaactgtcagcttcagcct
gctactaaggttgatgggccgaggtgtcctgctgtatttggagccatgctgtcctatgtc
agggaaatcttgggtgtttttggagttgatctattggacagaaaggaagtccatgattcc
tctggagttttaaataatgtggtggaggagttggtgcactttcgaagtaaggttcgtaaa
tttgctctttctgtgggagatcaagcttcacaaaatccccagactggctctgaaattcag
aaaaggcatccacagccagacagagtgcccttgcttaaggcctgtgatgccttaaggaat
aatctagcaccccttggagtccacattaaggatagaggcacaaactccacgtgggaaata
acaagaggaggagagacaaggaagaattaa

DBGET integrated database retrieval system