KEGG   Sinocyclocheilus rhinocerous: 107743135Help
Entry
107743135         CDS       T04916                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1B-like
  KO
K08795  pregnancy upregulated non-ubiquitously expressed CaM kinase [EC:2.7.11.17]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107743135
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107743135
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107743135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 FTA2 APH
Motif
Other DBs
NCBI-GeneID: 107743135
NCBI-ProteinID: XP_016411744
Position
Unknown
AA seq 333 aa AA seqDB search
MPLLRDLRKKDDINAVYELKEKLGEGSFSEVRVAQHRCTQKLVAVKCIRKRALKGKEPML
ENETAVLRRINHENIVSLEETFETPSKLYLVMTLLTGGELLDRILERGSYTEKDASRVIY
QVLQAVKYLHQLGVVHRDLKPENLLYETPLEDSKIVISDFGLSKMEEQGALSTACGTPAY
VAPELLQQKTYGKEVDLWAIGVITFILLCGYPPFYDDNDTQLYKLIIKAEYEFDSPYWDD
ISDSAKDLIVHLLQKDPAKRFNCDQALQHPWISGGAALDKNIHGSVSAQIQKNFAKSHWK
RAFNATIIVRHLTKKTHSGEDDEGNHSTSIGTI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctctattgagagatcttcggaagaaagatgacataaatgctgtttatgagctgaaa
gaaaaacttggagagggctcgttctctgaggttcgagtggctcagcacagatgcactcag
aagcttgtggctgtcaagtgcatccgcaagagagcgctaaagggaaaagaacccatgctg
gagaatgagactgcagtattacgcagaataaatcatgaaaatattgtgtctttggaggaa
acctttgagactccttctaaactgtatttggtaatgacactgctgacaggaggggaactg
ctggacaggattctggagagaggcagttacacagaaaaagatgccagtcgtgtgatatat
caggtgctgcaggcggtgaagtatctgcaccagctgggcgttgtgcatcgagatctaaag
ccagagaacttactgtatgagactccattagaagactccaaaattgtcatcagtgacttc
ggtctgtctaaaatggaagagcagggagctctttccacggcctgtgggacacctgcctat
gtcgctcctgaacttctacagcagaaaacatatggtaaagaggtggatctctgggccatc
ggggtcattacatttattctactctgtggctatcctccgttctatgatgacaacgacaca
caactctacaagctgatcataaaggctgaatatgaatttgattcgccatactgggacgac
atctctgactccgcgaaagacttaatagttcacttactgcagaaggatccagcgaagagg
ttcaattgtgaccaggccttgcagcatccttggatatcaggaggtgcggctctagacaag
aacatccacggctcagtgtcagcacagattcagaaaaactttgccaagagtcactggaag
agagcctttaatgccaccatcatcgtgcgtcatttaacaaagaaaacccactccggggaa
gacgatgaagggaatcactccacaagtatagggaccatctga

DBGET integrated database retrieval system